BLASTX nr result
ID: Aconitum23_contig00036002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00036002 (798 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002886871.1| predicted protein [Arabidopsis lyrata subsp.... 40 8e-06 gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 58 9e-06 >ref|XP_002886871.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297332712|gb|EFH63130.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 57 Score = 40.4 bits (93), Expect(2) = 8e-06 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = +2 Query: 452 MDSLLILIQLEVFIQFKKNYASRFHNPILGIYNIY 556 MD L+ILI+L + IQF KNY S FHNP L + ++ Sbjct: 1 MDPLVILIELSIVIQF-KNYVSEFHNPNLQLIRVF 34 Score = 37.4 bits (85), Expect(2) = 8e-06 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +1 Query: 565 FGYKSRECIFFLKSFIER*RMKSF 636 FGYK RE I FL+SFIER R KSF Sbjct: 34 FGYKLRESIIFLESFIERERTKSF 57 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 57.8 bits (138), Expect = 9e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 1 ARGYSRRQFII*NLNVSNSKPNMKLWFHSAPLWK 102 A+GYSRR+F +L+VSNSKPNMKLWFHSAPLW+ Sbjct: 26 AKGYSRRRFS--SLSVSNSKPNMKLWFHSAPLWR 57