BLASTX nr result
ID: Aconitum23_contig00035832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035832 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010255376.1| PREDICTED: cleavage and polyadenylation spec... 74 3e-11 ref|XP_011084423.1| PREDICTED: cleavage and polyadenylation spec... 74 4e-11 ref|XP_011008814.1| PREDICTED: cleavage and polyadenylation spec... 74 4e-11 gb|KDO52015.1| hypothetical protein CISIN_1g004656mg [Citrus sin... 74 4e-11 gb|KDO52014.1| hypothetical protein CISIN_1g004656mg [Citrus sin... 74 4e-11 ref|XP_006490412.1| PREDICTED: cleavage and polyadenylation spec... 74 4e-11 ref|XP_006421948.1| hypothetical protein CICLE_v10004414mg [Citr... 74 4e-11 ref|XP_006369487.1| Cleavage and polyadenylation specificity fac... 74 4e-11 ref|XP_007038718.1| Cleavage and polyadenylation specificity fac... 71 3e-10 ref|XP_012088265.1| PREDICTED: cleavage and polyadenylation spec... 71 4e-10 ref|XP_012440145.1| PREDICTED: cleavage and polyadenylation spec... 71 4e-10 gb|KHG29898.1| Cleavage and polyadenylation specificity factor s... 71 4e-10 ref|XP_012088264.1| PREDICTED: cleavage and polyadenylation spec... 71 4e-10 ref|XP_010662728.1| PREDICTED: cleavage and polyadenylation spec... 70 5e-10 emb|CDP05185.1| unnamed protein product [Coffea canephora] 70 5e-10 ref|XP_002268591.1| PREDICTED: cleavage and polyadenylation spec... 70 5e-10 ref|XP_010550556.1| PREDICTED: cleavage and polyadenylation spec... 70 6e-10 ref|XP_004499957.1| PREDICTED: cleavage and polyadenylation spec... 70 6e-10 ref|XP_008439247.1| PREDICTED: cleavage and polyadenylation spec... 70 8e-10 ref|XP_009789216.1| PREDICTED: cleavage and polyadenylation spec... 69 2e-09 >ref|XP_010255376.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 [Nelumbo nucifera] Length = 739 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAW+DA+VGK D+ MLS+LP S PPPPHKSV VGDLKL Sbjct: 627 GDYEIAWLDAQVGKTDNDMLSLLPLSTPPPPHKSVLVGDLKL 668 >ref|XP_011084423.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 [Sesamum indicum] Length = 740 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK +SG LS+LP S PPPPHK+V VGD+K+ Sbjct: 629 GDYEIAWVDAEVGKTESGTLSLLPLSTPPPPHKTVLVGDIKM 670 >ref|XP_011008814.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2-like [Populus euphratica] gi|743930763|ref|XP_011009640.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2-like [Populus euphratica] Length = 740 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYE+AWVDAEVGK ++GMLS+LP S P PPHKSV VGDLK+ Sbjct: 628 GDYEVAWVDAEVGKTENGMLSLLPISSPAPPHKSVLVGDLKM 669 >gb|KDO52015.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis] Length = 706 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++GMLS+LP S P PPHKSV VGDLK+ Sbjct: 594 GDYEIAWVDAEVGKTENGMLSLLPISTPAPPHKSVLVGDLKM 635 >gb|KDO52014.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis] Length = 721 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++GMLS+LP S P PPHKSV VGDLK+ Sbjct: 609 GDYEIAWVDAEVGKTENGMLSLLPISTPAPPHKSVLVGDLKM 650 >ref|XP_006490412.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2-like isoform X2 [Citrus sinensis] Length = 738 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++GMLS+LP S P PPHKSV VGDLK+ Sbjct: 626 GDYEIAWVDAEVGKTENGMLSLLPISTPAPPHKSVLVGDLKM 667 >ref|XP_006421948.1| hypothetical protein CICLE_v10004414mg [Citrus clementina] gi|568874619|ref|XP_006490411.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2-like isoform X1 [Citrus sinensis] gi|557523821|gb|ESR35188.1| hypothetical protein CICLE_v10004414mg [Citrus clementina] gi|641832993|gb|KDO52016.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis] Length = 739 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++GMLS+LP S P PPHKSV VGDLK+ Sbjct: 627 GDYEIAWVDAEVGKTENGMLSLLPISTPAPPHKSVLVGDLKM 668 >ref|XP_006369487.1| Cleavage and polyadenylation specificity factor family protein [Populus trichocarpa] gi|550348036|gb|ERP66056.1| Cleavage and polyadenylation specificity factor family protein [Populus trichocarpa] Length = 740 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYE+AWVDAEVGK ++GMLS+LP S P PPHKSV VGDLK+ Sbjct: 628 GDYEVAWVDAEVGKTENGMLSLLPISSPAPPHKSVLVGDLKM 669 >ref|XP_007038718.1| Cleavage and polyadenylation specificity factor 100 isoform 1 [Theobroma cacao] gi|508775963|gb|EOY23219.1| Cleavage and polyadenylation specificity factor 100 isoform 1 [Theobroma cacao] Length = 742 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++ MLS+LP S P PPHKSV VGDLKL Sbjct: 630 GDYEIAWVDAEVGKTENEMLSLLPLSTPAPPHKSVVVGDLKL 671 >ref|XP_012088265.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 isoform X2 [Jatropha curcas] Length = 740 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++ MLS+LP S PPPHKSV VGDLK+ Sbjct: 628 GDYEIAWVDAEVGKTENEMLSLLPISTSPPPHKSVLVGDLKM 669 >ref|XP_012440145.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 [Gossypium raimondii] gi|763785709|gb|KJB52780.1| hypothetical protein B456_008G276300 [Gossypium raimondii] Length = 742 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++ MLS+LP S P PPHKSV VGDLK+ Sbjct: 630 GDYEIAWVDAEVGKTENDMLSLLPISTPAPPHKSVVVGDLKM 671 >gb|KHG29898.1| Cleavage and polyadenylation specificity factor subunit 2 -like protein [Gossypium arboreum] Length = 692 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++ MLS+LP S P PPHKSV VGDLK+ Sbjct: 580 GDYEIAWVDAEVGKTENDMLSLLPISTPAPPHKSVVVGDLKM 621 >ref|XP_012088264.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 isoform X1 [Jatropha curcas] gi|643709706|gb|KDP24115.1| hypothetical protein JCGZ_25772 [Jatropha curcas] Length = 741 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAWVDAEVGK ++ MLS+LP S PPPHKSV VGDLK+ Sbjct: 629 GDYEIAWVDAEVGKTENEMLSLLPISTSPPPHKSVLVGDLKM 670 >ref|XP_010662728.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 isoform X2 [Vitis vinifera] Length = 691 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYE+AWVDAEVGK +SG LS+LP S PPP H +VFVGD+K+ Sbjct: 579 GDYEVAWVDAEVGKTESGSLSLLPLSTPPPSHDTVFVGDIKM 620 >emb|CDP05185.1| unnamed protein product [Coffea canephora] Length = 491 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 G+YEIAW+DAEVGK ++GMLS+LP S P PPHK+V VGD+K+ Sbjct: 379 GEYEIAWIDAEVGKTENGMLSLLPLSSPAPPHKTVLVGDIKM 420 >ref|XP_002268591.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 isoform X1 [Vitis vinifera] gi|302143847|emb|CBI22708.3| unnamed protein product [Vitis vinifera] Length = 740 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYE+AWVDAEVGK +SG LS+LP S PPP H +VFVGD+K+ Sbjct: 628 GDYEVAWVDAEVGKTESGSLSLLPLSTPPPSHDTVFVGDIKM 669 >ref|XP_010550556.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 isoform X1 [Tarenaya hassleriana] gi|729382079|ref|XP_010550557.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 isoform X2 [Tarenaya hassleriana] Length = 762 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASK--PPPPHKSVFVGDLKL 1 GDYE+AWVDAEVGK ++ MLSVLP S PPPPHKSV VGDLK+ Sbjct: 647 GDYEVAWVDAEVGKTETEMLSVLPMSSAAPPPPHKSVLVGDLKI 690 >ref|XP_004499957.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 [Cicer arietinum] Length = 740 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 G+YEIAWVDAEVGK ++ MLS+LP S PP PHKSV VGDLKL Sbjct: 628 GEYEIAWVDAEVGKAENDMLSLLPVSGPPRPHKSVLVGDLKL 669 >ref|XP_008439247.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 [Cucumis melo] Length = 738 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GDYEIAW+DAEVGK ++G LS+LP SK P PHKSV VGDLK+ Sbjct: 626 GDYEIAWLDAEVGKTENGTLSLLPLSKAPAPHKSVLVGDLKM 667 >ref|XP_009789216.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 [Nicotiana sylvestris] Length = 739 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 126 GDYEIAWVDAEVGKMDSGMLSVLPASKPPPPHKSVFVGDLKL 1 GD+EIAWVDAEVGK ++GM+S+LP S P PPHK+V VGD+K+ Sbjct: 627 GDHEIAWVDAEVGKTENGMISLLPFSGPAPPHKTVLVGDIKM 668