BLASTX nr result
ID: Aconitum23_contig00035282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035282 (354 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522932.1| conserved hypothetical protein [Ricinus comm... 60 8e-07 >ref|XP_002522932.1| conserved hypothetical protein [Ricinus communis] gi|223537826|gb|EEF39443.1| conserved hypothetical protein [Ricinus communis] Length = 303 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/47 (51%), Positives = 33/47 (70%) Frame = -3 Query: 352 WPTSCVKEAEKMLRNFLWTESITSSKNIVVKWGTVTKPLKCGGLGIK 212 WP+S +K EK +RNFLWT S++ K + VKWG KP+ GG+G+K Sbjct: 197 WPSSLLKSIEKAIRNFLWTGSVSYKKLVTVKWGHCCKPISEGGIGLK 243