BLASTX nr result
ID: Aconitum23_contig00035260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035260 (423 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002966273.1| hypothetical protein SELMODRAFT_230840 [Sela... 57 4e-06 ref|XP_002978301.1| hypothetical protein SELMODRAFT_108289 [Sela... 57 4e-06 ref|XP_010272609.1| PREDICTED: protein FIZZY-RELATED 1-like [Nel... 57 5e-06 ref|XP_014510042.1| PREDICTED: protein FIZZY-RELATED 2-like [Vig... 57 7e-06 gb|KRH04001.1| hypothetical protein GLYMA_17G133000 [Glycine max] 57 7e-06 gb|KOM32661.1| hypothetical protein LR48_Vigan01g221700 [Vigna a... 57 7e-06 gb|KNA23652.1| hypothetical protein SOVF_023120 [Spinacia oleracea] 57 7e-06 gb|KHN09741.1| Protein FIZZY-RELATED 2 [Glycine soja] 57 7e-06 ref|XP_010255597.1| PREDICTED: protein FIZZY-RELATED 2-like [Nel... 57 7e-06 ref|XP_007155576.1| hypothetical protein PHAVU_003G213700g [Phas... 57 7e-06 ref|XP_003550882.1| PREDICTED: protein FIZZY-RELATED 2-like [Gly... 57 7e-06 ref|XP_003525549.1| PREDICTED: protein FIZZY-RELATED 2-like [Gly... 57 7e-06 ref|XP_010455611.1| PREDICTED: protein FIZZY-RELATED 1-like [Cam... 56 9e-06 ref|XP_010422148.1| PREDICTED: protein FIZZY-RELATED 1 [Camelina... 56 9e-06 emb|CBI34773.3| unnamed protein product [Vitis vinifera] 56 9e-06 ref|XP_002275649.1| PREDICTED: protein FIZZY-RELATED 2 [Vitis vi... 56 9e-06 ref|XP_002874733.1| WD-40 repeat family protein [Arabidopsis lyr... 56 9e-06 emb|CAN65426.1| hypothetical protein VITISV_029497 [Vitis vinifera] 56 9e-06 >ref|XP_002966273.1| hypothetical protein SELMODRAFT_230840 [Selaginella moellendorffii] gi|300165693|gb|EFJ32300.1| hypothetical protein SELMODRAFT_230840 [Selaginella moellendorffii] Length = 490 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV*TA 257 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ +A Sbjct: 169 FKVLDAPALQDDFYLNLVDWSAHNVLAVGLGNCVYLWSA 207 >ref|XP_002978301.1| hypothetical protein SELMODRAFT_108289 [Selaginella moellendorffii] gi|300154322|gb|EFJ20958.1| hypothetical protein SELMODRAFT_108289 [Selaginella moellendorffii] Length = 490 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV*TA 257 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ +A Sbjct: 169 FKVLDAPALQDDFYLNLVDWSAHNVLAVGLGNCVYLWSA 207 >ref|XP_010272609.1| PREDICTED: protein FIZZY-RELATED 1-like [Nelumbo nucifera] Length = 511 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 367 VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 VLDAP+LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 195 VLDAPQLQDDFYLNLVDWSSHNVLAVGLGNCVYL 228 >ref|XP_014510042.1| PREDICTED: protein FIZZY-RELATED 2-like [Vigna radiata var. radiata] Length = 473 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 155 FKVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYL 190 >gb|KRH04001.1| hypothetical protein GLYMA_17G133000 [Glycine max] Length = 526 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 208 FKVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYL 243 >gb|KOM32661.1| hypothetical protein LR48_Vigan01g221700 [Vigna angularis] Length = 464 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 155 FKVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYL 190 >gb|KNA23652.1| hypothetical protein SOVF_023120 [Spinacia oleracea] Length = 501 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 183 FKVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYL 218 >gb|KHN09741.1| Protein FIZZY-RELATED 2 [Glycine soja] Length = 343 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 25 FKVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYL 60 >ref|XP_010255597.1| PREDICTED: protein FIZZY-RELATED 2-like [Nelumbo nucifera] Length = 509 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 367 VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 VLDAP+LQDDFYL LVD S HN+LAVGLGN VY+ Sbjct: 193 VLDAPQLQDDFYLNLVDWSSHNILAVGLGNCVYL 226 >ref|XP_007155576.1| hypothetical protein PHAVU_003G213700g [Phaseolus vulgaris] gi|561028930|gb|ESW27570.1| hypothetical protein PHAVU_003G213700g [Phaseolus vulgaris] Length = 473 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 155 FKVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYL 190 >ref|XP_003550882.1| PREDICTED: protein FIZZY-RELATED 2-like [Glycine max] Length = 465 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 147 FKVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYL 182 >ref|XP_003525549.1| PREDICTED: protein FIZZY-RELATED 2-like [Glycine max] gi|947108949|gb|KRH57275.1| hypothetical protein GLYMA_05G051100 [Glycine max] Length = 459 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 373 F*VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 F VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 141 FKVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYL 176 >ref|XP_010455611.1| PREDICTED: protein FIZZY-RELATED 1-like [Camelina sativa] Length = 475 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 367 VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 159 VLDAPALQDDFYLNLVDWSAHNVLAVGLGNCVYL 192 >ref|XP_010422148.1| PREDICTED: protein FIZZY-RELATED 1 [Camelina sativa] Length = 474 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 367 VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 158 VLDAPALQDDFYLNLVDWSAHNVLAVGLGNCVYL 191 >emb|CBI34773.3| unnamed protein product [Vitis vinifera] Length = 429 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 367 VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 113 VLDAPALQDDFYLNLVDWSAHNVLAVGLGNCVYL 146 >ref|XP_002275649.1| PREDICTED: protein FIZZY-RELATED 2 [Vitis vinifera] Length = 497 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 367 VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 181 VLDAPALQDDFYLNLVDWSAHNVLAVGLGNCVYL 214 >ref|XP_002874733.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297320570|gb|EFH50992.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 474 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 367 VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 158 VLDAPALQDDFYLNLVDWSAHNVLAVGLGNCVYL 191 >emb|CAN65426.1| hypothetical protein VITISV_029497 [Vitis vinifera] Length = 469 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 367 VLDAPELQDDFYLYLVDRSLHNVLAVGLGN*VYV 266 VLDAP LQDDFYL LVD S HNVLAVGLGN VY+ Sbjct: 153 VLDAPALQDDFYLNLVDWSAHNVLAVGLGNCVYL 186