BLASTX nr result
ID: Aconitum23_contig00035152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035152 (421 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBJ20761.1| hypothetical protein [Beta vulgaris subsp. marit... 80 5e-13 >emb|CBJ20761.1| hypothetical protein [Beta vulgaris subsp. maritima] Length = 135 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = +3 Query: 168 GPIHTSELVLPRSIYPSIFHFRTNSSYLNRYLSSISMARRVWKES 302 GPIHTS LVLP SIYPSIFHF TN SYLN YLSSISMARRVW+ES Sbjct: 91 GPIHTSVLVLPGSIYPSIFHFGTNPSYLNPYLSSISMARRVWEES 135