BLASTX nr result
ID: Aconitum23_contig00034411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00034411 (757 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006304215.1| hypothetical protein CARUB_v10010325mg [Caps... 58 6e-06 >ref|XP_006304215.1| hypothetical protein CARUB_v10010325mg [Capsella rubella] gi|482572926|gb|EOA37113.1| hypothetical protein CARUB_v10010325mg [Capsella rubella] Length = 203 Score = 58.2 bits (139), Expect = 6e-06 Identities = 34/71 (47%), Positives = 44/71 (61%), Gaps = 12/71 (16%) Frame = -3 Query: 179 LTLVFPYE--ICFRPR----------FLWSDLGLFGSSIPSTFSGKEMAPLFGFLGDASA 36 LT+ F ++ +CF P+ F SDL G ++ S+FSG E AP FGFLG A+A Sbjct: 3 LTVYFQFDWFLCFSPKSSKHNFFFVSFPRSDL--IGRAMASSFSGDETAPFFGFLGAAAA 60 Query: 35 LIFLCMGAAYG 3 L+F CMGAAYG Sbjct: 61 LVFSCMGAAYG 71