BLASTX nr result
ID: Aconitum23_contig00034119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00034119 (420 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADK13052.1| asparagine synthetase [Pinus pinaster] 75 2e-11 ref|XP_011024933.1| PREDICTED: asparagine synthetase [glutamine-... 75 3e-11 ref|XP_002299991.2| asparagine synthetase family protein [Populu... 75 3e-11 ref|WP_056621942.1| asparagine synthetase B, partial [Paenibacil... 74 3e-11 gb|KHG11567.1| Asparagine synthetase [glutamine-hydrolyzing] 1 [... 74 3e-11 gb|AAU89392.1| glutamine-dependent asparagine synthetase [Tritic... 74 3e-11 ref|XP_012839285.1| PREDICTED: asparagine synthetase [glutamine-... 74 3e-11 gb|EMT27682.1| Asparagine glutamine-hydrolyzing synthetase [Aegi... 74 3e-11 sp|O24338.3|ASNS_SANAU RecName: Full=Asparagine synthetase [glut... 74 3e-11 ref|XP_003579059.1| PREDICTED: asparagine synthetase [glutamine-... 74 3e-11 gb|AAK49456.1|AF307145_1 glutamine-dependent asparagine syntheta... 74 3e-11 gb|ABR16560.1| unknown [Picea sitchensis] 74 6e-11 ref|NP_001131013.1| asparagine synthetase2 [Zea mays] gi|2053624... 74 6e-11 ref|XP_006843600.1| PREDICTED: asparagine synthetase [glutamine-... 74 6e-11 tpg|DAA59148.1| TPA: hypothetical protein ZEAMMB73_422165 [Zea m... 74 6e-11 ref|XP_003601953.1| asparagine synthetase [glutamine-hydrolyzing... 74 6e-11 emb|CAN82675.1| hypothetical protein VITISV_034450 [Vitis vinifera] 74 6e-11 ref|XP_011003961.1| PREDICTED: asparagine synthetase [glutamine-... 73 7e-11 gb|AHA44834.1| asparagine synthetase [Larix kaempferi] 73 7e-11 ref|XP_002313246.2| asparagine synthetase family protein [Populu... 73 7e-11 >gb|ADK13052.1| asparagine synthetase [Pinus pinaster] Length = 590 Score = 75.1 bits (183), Expect = 2e-11 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEELMGLLLQQHMSLSPEVKTRPNRS 250 KIKSLGVKMV+SGEGSDEIFGGYLYFHKAPNKEEL Q+ SL R N+S Sbjct: 330 KIKSLGVKMVLSGEGSDEIFGGYLYFHKAPNKEELHRETCQKIKSLHLYDCLRANKS 386 >ref|XP_011024933.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 isoform X1 [Populus euphratica] gi|743835110|ref|XP_011024934.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 isoform X2 [Populus euphratica] Length = 587 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEELMG 310 KIK+LGVKMVISGEGSDEIFGGYLYFHKAPNKEEL G Sbjct: 330 KIKALGVKMVISGEGSDEIFGGYLYFHKAPNKEELHG 366 >ref|XP_002299991.2| asparagine synthetase family protein [Populus trichocarpa] gi|550348388|gb|EEE84796.2| asparagine synthetase family protein [Populus trichocarpa] Length = 578 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEELMG 310 KIK+LGVKMVISGEGSDEIFGGYLYFHKAPNKEEL G Sbjct: 321 KIKALGVKMVISGEGSDEIFGGYLYFHKAPNKEELHG 357 >ref|WP_056621942.1| asparagine synthetase B, partial [Paenibacillus sp. Soil750] gi|946408552|gb|KRE59045.1| asparagine synthetase B, partial [Paenibacillus sp. Soil750] Length = 479 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 224 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 258 >gb|KHG11567.1| Asparagine synthetase [glutamine-hydrolyzing] 1 [Gossypium arboreum] Length = 558 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 303 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 337 >gb|AAU89392.1| glutamine-dependent asparagine synthetase [Triticum aestivum] Length = 585 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 364 >ref|XP_012839285.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Erythranthe guttatus] gi|604347471|gb|EYU45708.1| hypothetical protein MIMGU_mgv1a003412mg [Erythranthe guttata] Length = 586 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 364 >gb|EMT27682.1| Asparagine glutamine-hydrolyzing synthetase [Aegilops tauschii] Length = 590 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 335 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 369 >sp|O24338.3|ASNS_SANAU RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; AltName: Full=Glutamine-dependent asparagine synthetase gi|2245622|gb|AAB71532.1| asparagine synthetase [Sandersonia aurantiaca] Length = 525 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 364 >ref|XP_003579059.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like [Brachypodium distachyon] gi|944057010|gb|KQJ92648.1| hypothetical protein BRADI_4g45010 [Brachypodium distachyon] Length = 585 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 364 >gb|AAK49456.1|AF307145_1 glutamine-dependent asparagine synthetase 1 [Hordeum vulgare subsp. vulgare] gi|326501150|dbj|BAJ98806.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326504294|dbj|BAJ90979.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 585 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 364 >gb|ABR16560.1| unknown [Picea sitchensis] Length = 590 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMV+SGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVLSGEGSDEIFGGYLYFHKAPNKEEL 364 >ref|NP_001131013.1| asparagine synthetase2 [Zea mays] gi|205362420|emb|CAR70073.1| asparagine synthetase [Zea mays] gi|208011517|emb|CAR82079.1| asparagine synthetase [Zea mays] gi|223947911|gb|ACN28039.1| unknown [Zea mays] gi|223949581|gb|ACN28874.1| unknown [Zea mays] gi|238006400|gb|ACR34235.1| unknown [Zea mays] gi|414882016|tpg|DAA59147.1| TPA: asparagine synthetase [Zea mays] Length = 606 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDE+FGGYLYFHKAPNKEEL Sbjct: 347 KIKSLGVKMVISGEGSDELFGGYLYFHKAPNKEEL 381 >ref|XP_006843600.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Amborella trichopoda] gi|548845968|gb|ERN05275.1| hypothetical protein AMTR_s00007p00134530 [Amborella trichopoda] Length = 590 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMV+SGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVLSGEGSDEIFGGYLYFHKAPNKEEL 364 >tpg|DAA59148.1| TPA: hypothetical protein ZEAMMB73_422165 [Zea mays] Length = 615 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMVISGEGSDE+FGGYLYFHKAPNKEEL Sbjct: 356 KIKSLGVKMVISGEGSDELFGGYLYFHKAPNKEEL 390 >ref|XP_003601953.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago truncatula] gi|355491001|gb|AES72204.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago truncatula] Length = 570 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMV+SGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVLSGEGSDEIFGGYLYFHKAPNKEEL 364 >emb|CAN82675.1| hypothetical protein VITISV_034450 [Vitis vinifera] Length = 636 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMV+SGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 366 KIKSLGVKMVLSGEGSDEIFGGYLYFHKAPNKEEL 400 >ref|XP_011003961.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like [Populus euphratica] Length = 589 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIK+LGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKALGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 364 >gb|AHA44834.1| asparagine synthetase [Larix kaempferi] Length = 589 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIKSLGVKMV+SGEGSDE+FGGYLYFHKAPNKEEL Sbjct: 330 KIKSLGVKMVLSGEGSDEVFGGYLYFHKAPNKEEL 364 >ref|XP_002313246.2| asparagine synthetase family protein [Populus trichocarpa] gi|550331247|gb|EEE87201.2| asparagine synthetase family protein [Populus trichocarpa] Length = 589 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 420 KIKSLGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 316 KIK+LGVKMVISGEGSDEIFGGYLYFHKAPNKEEL Sbjct: 330 KIKALGVKMVISGEGSDEIFGGYLYFHKAPNKEEL 364