BLASTX nr result
ID: Aconitum23_contig00033790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00033790 (426 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614156.2| ureide permease-like protein [Medicago trunc... 71 4e-10 ref|XP_004490191.1| PREDICTED: ureide permease 1-like isoform X1... 70 8e-10 ref|XP_004239052.1| PREDICTED: ureide permease 1 isoform X1 [Sol... 70 8e-10 ref|XP_002512085.1| Ureide permease, putative [Ricinus communis]... 69 1e-09 ref|XP_011018538.1| PREDICTED: ureide permease 1-like [Populus e... 68 2e-09 gb|KHG08043.1| Ureide permease 2 -like protein [Gossypium arboreum] 68 2e-09 emb|CDY04157.1| BnaA09g19350D [Brassica napus] 68 2e-09 ref|XP_006348693.1| PREDICTED: ureide permease 1-like isoform X1... 68 2e-09 ref|XP_002311338.2| hypothetical protein POPTR_0008s09510g [Popu... 68 2e-09 ref|XP_006379691.1| hypothetical protein POPTR_0008s09510g [Popu... 68 2e-09 ref|XP_009591943.1| PREDICTED: ureide permease 1-like isoform X2... 68 3e-09 ref|XP_009591942.1| PREDICTED: ureide permease 1-like isoform X1... 68 3e-09 emb|CDY33101.1| BnaC09g21970D [Brassica napus] 67 4e-09 gb|KDO70383.1| hypothetical protein CISIN_1g0155141mg, partial [... 67 4e-09 gb|EYU28861.1| hypothetical protein MIMGU_mgv1a006580mg [Erythra... 67 4e-09 ref|XP_006437937.1| hypothetical protein CICLE_v10031708mg [Citr... 67 4e-09 ref|XP_014492897.1| PREDICTED: ureide permease 1-like [Vigna rad... 67 5e-09 ref|XP_010425148.1| PREDICTED: ureide permease 2-like [Camelina ... 67 5e-09 ref|XP_010502368.1| PREDICTED: ureide permease 2 isoform X1 [Cam... 67 5e-09 ref|XP_002512081.1| Ureide permease, putative [Ricinus communis]... 67 5e-09 >ref|XP_003614156.2| ureide permease-like protein [Medicago truncatula] gi|657384804|gb|AES97114.2| ureide permease-like protein [Medicago truncatula] Length = 403 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+++ESKGGAIVCMLF++ G+WPAVMNLLERRGR PQHT Sbjct: 1 MYLVESKGGAIVCMLFSLFFLGTWPAVMNLLERRGRLPQHT 41 >ref|XP_004490191.1| PREDICTED: ureide permease 1-like isoform X1 [Cicer arietinum] gi|828294548|ref|XP_012568328.1| PREDICTED: ureide permease 1-like isoform X2 [Cicer arietinum] Length = 400 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+M+ESKGGAIVCMLF++ G+WPAVM LLERRGR PQHT Sbjct: 1 MYMVESKGGAIVCMLFSLFFLGTWPAVMTLLERRGRLPQHT 41 >ref|XP_004239052.1| PREDICTED: ureide permease 1 isoform X1 [Solanum lycopersicum] Length = 475 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 5/64 (7%) Frame = -2 Query: 179 ISHWYTIQFGVF-----FSSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRH 15 + +W + VF SS M+M+ESKGGAI CMLF+++ G+WPA++ LLERRGR Sbjct: 47 MDYWSLTKLAVFSPERVLSSRFKMYMVESKGGAIACMLFSLLLLGTWPALLTLLERRGRL 106 Query: 14 PQHT 3 PQHT Sbjct: 107 PQHT 110 >ref|XP_002512085.1| Ureide permease, putative [Ricinus communis] gi|223549265|gb|EEF50754.1| Ureide permease, putative [Ricinus communis] Length = 418 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -2 Query: 140 SSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 SS +M+++ESKGGAI CML ++ C G+WPA+ LLERRGR PQHT Sbjct: 19 SSGLEMYLVESKGGAIACMLLSLFCLGTWPAIFTLLERRGRLPQHT 64 >ref|XP_011018538.1| PREDICTED: ureide permease 1-like [Populus euphratica] gi|743783003|ref|XP_011018546.1| PREDICTED: ureide permease 1-like [Populus euphratica] Length = 404 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+++ESKGGAIVCMLF++ G+WPA+M LLERRGR PQHT Sbjct: 1 MYLVESKGGAIVCMLFSLFFLGTWPAIMTLLERRGRLPQHT 41 >gb|KHG08043.1| Ureide permease 2 -like protein [Gossypium arboreum] Length = 430 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 9/64 (14%) Frame = -2 Query: 167 YTIQFGVFFSSDED---------MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRH 15 ++I + F S ED M+++ESKGGAIVCML A++ G+WPA++ LLERRGR Sbjct: 6 FSILYSFIFPSSEDCIRNSRVKIMYIVESKGGAIVCMLLALLFLGTWPALITLLERRGRL 65 Query: 14 PQHT 3 PQHT Sbjct: 66 PQHT 69 >emb|CDY04157.1| BnaA09g19350D [Brassica napus] Length = 494 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = -2 Query: 197 YKSKLVISHWYTIQFGVFFSSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGR 18 Y ++ S + F V+ S E M+++ESKGGAI CML A++ G+WPA+M L ERRGR Sbjct: 75 YSLYILFSLQFFCDFIVYIES-EKMYIIESKGGAIACMLLALLFLGTWPAIMTLTERRGR 133 Query: 17 HPQHT 3 PQHT Sbjct: 134 LPQHT 138 >ref|XP_006348693.1| PREDICTED: ureide permease 1-like isoform X1 [Solanum tuberosum] Length = 466 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 5/64 (7%) Frame = -2 Query: 179 ISHWYTIQFGVF-----FSSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRH 15 + +W + VF SS M+M+ESK GAI CMLF+++ G+WPA++ LLERRGR Sbjct: 38 MDYWSLTKLAVFSPERVLSSGFKMYMVESKDGAIACMLFSLLLLGTWPALLTLLERRGRF 97 Query: 14 PQHT 3 PQHT Sbjct: 98 PQHT 101 >ref|XP_002311338.2| hypothetical protein POPTR_0008s09510g [Populus trichocarpa] gi|566183146|ref|XP_006379692.1| hypothetical protein POPTR_0008s09510g [Populus trichocarpa] gi|550332729|gb|EEE88705.2| hypothetical protein POPTR_0008s09510g [Populus trichocarpa] gi|550332730|gb|ERP57489.1| hypothetical protein POPTR_0008s09510g [Populus trichocarpa] Length = 404 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+++ESKGGAIVCMLF++ G+WPA+M LLERRGR PQHT Sbjct: 1 MYLVESKGGAIVCMLFSLFFLGTWPAIMTLLERRGRLPQHT 41 >ref|XP_006379691.1| hypothetical protein POPTR_0008s09510g [Populus trichocarpa] gi|550332728|gb|ERP57488.1| hypothetical protein POPTR_0008s09510g [Populus trichocarpa] Length = 364 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+++ESKGGAIVCMLF++ G+WPA+M LLERRGR PQHT Sbjct: 1 MYLVESKGGAIVCMLFSLFFLGTWPAIMTLLERRGRLPQHT 41 >ref|XP_009591943.1| PREDICTED: ureide permease 1-like isoform X2 [Nicotiana tomentosiformis] Length = 430 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = -2 Query: 179 ISHWYTIQFGVFFSSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 IS+ T+ SS M+++ESKGGAIVCML ++ G+WPA++ LLERRGR+PQHT Sbjct: 6 ISNLITLSPERVLSSGLKMYVVESKGGAIVCMLLSLFFLGTWPALLTLLERRGRYPQHT 64 >ref|XP_009591942.1| PREDICTED: ureide permease 1-like isoform X1 [Nicotiana tomentosiformis] Length = 441 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = -2 Query: 179 ISHWYTIQFGVFFSSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 IS+ T+ SS M+++ESKGGAIVCML ++ G+WPA++ LLERRGR+PQHT Sbjct: 17 ISNLITLSPERVLSSGLKMYVVESKGGAIVCMLLSLFFLGTWPALLTLLERRGRYPQHT 75 >emb|CDY33101.1| BnaC09g21970D [Brassica napus] Length = 446 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 131 EDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 E M+M+ESKGGAI CML A++ G+WPA+M L ERRGR PQHT Sbjct: 48 EKMYMIESKGGAIACMLLALLFLGTWPAIMTLTERRGRLPQHT 90 >gb|KDO70383.1| hypothetical protein CISIN_1g0155141mg, partial [Citrus sinensis] gi|641851513|gb|KDO70384.1| hypothetical protein CISIN_1g0155141mg, partial [Citrus sinensis] Length = 78 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+M+ESK GAIVCMLF++ G+WPA+M LLERRGR PQHT Sbjct: 1 MYMVESKAGAIVCMLFSLFFLGTWPAIMTLLERRGRPPQHT 41 >gb|EYU28861.1| hypothetical protein MIMGU_mgv1a006580mg [Erythranthe guttata] Length = 438 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = -2 Query: 164 TIQFGVFFSSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 +I+ G SS M+++ESKGGAI CML A+ G+WPA++ LLERRGR PQHT Sbjct: 11 SIEEGEVVSSRLKMYLVESKGGAIACMLLALFFLGTWPAILTLLERRGRLPQHT 64 >ref|XP_006437937.1| hypothetical protein CICLE_v10031708mg [Citrus clementina] gi|568861421|ref|XP_006484201.1| PREDICTED: ureide permease 1-like isoform X1 [Citrus sinensis] gi|568861423|ref|XP_006484202.1| PREDICTED: ureide permease 1-like isoform X2 [Citrus sinensis] gi|557540133|gb|ESR51177.1| hypothetical protein CICLE_v10031708mg [Citrus clementina] Length = 405 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+M+ESK GAIVCMLF++ G+WPA+M LLERRGR PQHT Sbjct: 1 MYMVESKAGAIVCMLFSLFFLGTWPAIMTLLERRGRPPQHT 41 >ref|XP_014492897.1| PREDICTED: ureide permease 1-like [Vigna radiata var. radiata] Length = 402 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+++ESKGGAIVCML +++ G+WPAVM LLERRGR PQHT Sbjct: 1 MYLIESKGGAIVCMLVSLLFLGTWPAVMTLLERRGRLPQHT 41 >ref|XP_010425148.1| PREDICTED: ureide permease 2-like [Camelina sativa] Length = 428 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = -2 Query: 149 VFFSSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 + F+ +M+++ESKGGAI CM+ A++ G+WPA++ LLERRGR PQHT Sbjct: 27 IHFNRSLNMYLVESKGGAIACMILALLSLGTWPAILTLLERRGRLPQHT 75 >ref|XP_010502368.1| PREDICTED: ureide permease 2 isoform X1 [Camelina sativa] Length = 428 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = -2 Query: 149 VFFSSDEDMFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 + F+ +M+++ESKGGAI CM+ A++ G+WPA++ LLERRGR PQHT Sbjct: 27 IHFNRSLNMYLVESKGGAIACMILALLSLGTWPAILTLLERRGRLPQHT 75 >ref|XP_002512081.1| Ureide permease, putative [Ricinus communis] gi|223549261|gb|EEF50750.1| Ureide permease, putative [Ricinus communis] Length = 406 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 125 MFMLESKGGAIVCMLFAIICQGSWPAVMNLLERRGRHPQHT 3 M+M+ESKGGAI+CML ++ G+WPA+M LLERRGR PQHT Sbjct: 1 MYMIESKGGAIICMLLSLFFLGTWPAIMTLLERRGRLPQHT 41