BLASTX nr result
ID: Aconitum23_contig00033504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00033504 (331 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIX10938.1| putative protein phosphatase inhibitor [Gardenia ... 60 6e-07 ref|XP_010255482.1| PREDICTED: uncharacterized protein LOC104596... 59 1e-06 ref|XP_010255480.1| PREDICTED: protein phosphatase inhibitor 2-l... 59 1e-06 ref|XP_010255479.1| PREDICTED: protein phosphatase inhibitor 2-l... 59 1e-06 ref|XP_009760428.1| PREDICTED: protein GLC8 [Nicotiana sylvestris] 57 5e-06 ref|XP_008377464.1| PREDICTED: protein phosphatase inhibitor 2-l... 57 5e-06 ref|XP_008377451.1| PREDICTED: protein phosphatase inhibitor 2-l... 57 5e-06 >gb|AIX10938.1| putative protein phosphatase inhibitor [Gardenia jasminoides] Length = 180 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 272 SKKFRDHRRAHYDEYRKVKELQRKGSLVDDGVDAED 165 S+ FR+HRRAHYDE+RKVKEL+RKGSL++D D ED Sbjct: 105 SRTFREHRRAHYDEFRKVKELRRKGSLLEDASDDED 140 >ref|XP_010255482.1| PREDICTED: uncharacterized protein LOC104596142 isoform X3 [Nelumbo nucifera] Length = 154 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 272 SKKFRDHRRAHYDEYRKVKELQRKGSLVDDGVDAED 165 S FR+HR+AHYDEYRKVKELQ+KGSL++D D ED Sbjct: 77 SLSFREHRKAHYDEYRKVKELQQKGSLLNDEADEED 112 >ref|XP_010255480.1| PREDICTED: protein phosphatase inhibitor 2-like isoform X2 [Nelumbo nucifera] Length = 183 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 272 SKKFRDHRRAHYDEYRKVKELQRKGSLVDDGVDAED 165 S FR+HR+AHYDEYRKVKELQ+KGSL++D D ED Sbjct: 106 SLSFREHRKAHYDEYRKVKELQQKGSLLNDEADEED 141 >ref|XP_010255479.1| PREDICTED: protein phosphatase inhibitor 2-like isoform X1 [Nelumbo nucifera] Length = 188 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 272 SKKFRDHRRAHYDEYRKVKELQRKGSLVDDGVDAED 165 S FR+HR+AHYDEYRKVKELQ+KGSL++D D ED Sbjct: 111 SLSFREHRKAHYDEYRKVKELQQKGSLLNDEADEED 146 >ref|XP_009760428.1| PREDICTED: protein GLC8 [Nicotiana sylvestris] Length = 175 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -3 Query: 269 KKFRDHRRAHYDEYRKVKELQRKGSLVDDGVDAED 165 K F++HRRAHYDEYR+VKEL+RKGS +++ D ED Sbjct: 107 KSFKEHRRAHYDEYRRVKELRRKGSFLEEASDGED 141 >ref|XP_008377464.1| PREDICTED: protein phosphatase inhibitor 2-like isoform X2 [Malus domestica] gi|657944991|ref|XP_008377471.1| PREDICTED: protein phosphatase inhibitor 2-like isoform X2 [Malus domestica] Length = 186 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 272 SKKFRDHRRAHYDEYRKVKELQRKGSLVDDGVDAED 165 SK FR+HRRAHYDE++KVKEL+RK SL+DD + ED Sbjct: 106 SKSFREHRRAHYDEFQKVKELRRKASLLDDEEEDED 141 >ref|XP_008377451.1| PREDICTED: protein phosphatase inhibitor 2-like isoform X1 [Malus domestica] gi|657944987|ref|XP_008377457.1| PREDICTED: protein phosphatase inhibitor 2-like isoform X1 [Malus domestica] Length = 188 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 272 SKKFRDHRRAHYDEYRKVKELQRKGSLVDDGVDAED 165 SK FR+HRRAHYDE++KVKEL+RK SL+DD + ED Sbjct: 108 SKSFREHRRAHYDEFQKVKELRRKASLLDDEEEDED 143