BLASTX nr result
ID: Aconitum23_contig00033073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00033073 (692 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010263518.1| PREDICTED: probable BOI-related E3 ubiquitin... 58 5e-06 >ref|XP_010263518.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Nelumbo nucifera] Length = 334 Score = 58.2 bits (139), Expect = 5e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 586 RIASSADSPVFSILDDQITRELQRQEAEMDRFIK 687 RI SS DSP+FS+LDD I RELQRQEAEMDRF+K Sbjct: 124 RITSSGDSPLFSLLDDDIDRELQRQEAEMDRFVK 157