BLASTX nr result
ID: Aconitum23_contig00032978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00032978 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009341595.1| PREDICTED: uncharacterized protein LOC103933... 60 5e-07 ref|XP_009355139.1| PREDICTED: uncharacterized protein LOC103946... 60 5e-07 ref|XP_013463386.1| DUF4283 domain protein [Medicago truncatula]... 57 7e-06 >ref|XP_009341595.1| PREDICTED: uncharacterized protein LOC103933633 [Pyrus x bretschneideri] Length = 572 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/92 (32%), Positives = 51/92 (55%), Gaps = 4/92 (4%) Frame = +1 Query: 67 TITQMDLPAPVIKGNLPSIKLAPHVEARGLLYCQTALVGRLDLNL----LKTDKVREMAK 234 ++ LP+P ++G++ +K++ + L C+T L+GRL L +KT+ ++ Sbjct: 119 SVNLSQLPSPAVRGDVTYVKISEDLYQEQLRSCRTNLIGRLLLKKGTMPMKTEFLKSALA 178 Query: 235 TLWKPSESCKTIPLGRGYVMFRFDLQADADRV 330 +LWKP S K +PLG+GY F + D RV Sbjct: 179 SLWKPHNSWKLVPLGKGYFDLHFSNEEDVRRV 210 >ref|XP_009355139.1| PREDICTED: uncharacterized protein LOC103946202 [Pyrus x bretschneideri] Length = 572 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/92 (32%), Positives = 51/92 (55%), Gaps = 4/92 (4%) Frame = +1 Query: 67 TITQMDLPAPVIKGNLPSIKLAPHVEARGLLYCQTALVGRLDLNL----LKTDKVREMAK 234 ++ LP+P ++G++ +K++ + L C+T L+GRL L +KT+ ++ Sbjct: 119 SVNLSQLPSPTVRGDVTYVKISEDLYQEQLRSCRTNLIGRLLLKKGTMPMKTEFLKSALA 178 Query: 235 TLWKPSESCKTIPLGRGYVMFRFDLQADADRV 330 +LWKP S K +PLG+GY F + D RV Sbjct: 179 SLWKPHNSWKLVPLGKGYFDLHFSNEEDVRRV 210 >ref|XP_013463386.1| DUF4283 domain protein [Medicago truncatula] gi|657397704|gb|KEH37404.1| DUF4283 domain protein [Medicago truncatula] Length = 459 Score = 56.6 bits (135), Expect = 7e-06 Identities = 41/121 (33%), Positives = 55/121 (45%), Gaps = 4/121 (3%) Frame = +1 Query: 1 PQISPDGDVVKQKLPWCLLGPQTITQMDLPAPVIKGNLPSIKLAPHVEARGLLYCQTALV 180 P + P V + LL ++ DLP P KG+ SIK++ GL L Sbjct: 48 PSVVPH-TVSNRNFAQALLNKIEVSVSDLPKPCWKGDSLSIKISEAGYQTGLANSNNYLH 106 Query: 181 GRLDLNL----LKTDKVREMAKTLWKPSESCKTIPLGRGYVMFRFDLQADADRVNSVPSW 348 GRL L+ + + +RE LWKP K IPLGRG+ FRF D V S +W Sbjct: 107 GRLMLSRGDKPISSKDLREKLLLLWKPLNQWKMIPLGRGFFEFRFSCADDLRSVWSHGAW 166 Query: 349 S 351 + Sbjct: 167 N 167