BLASTX nr result
ID: Aconitum23_contig00030513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00030513 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA19577.1| lectin [Epipactis helleborine] 67 4e-09 gb|AAC37359.1| mannose specific lectin, partial [Allium cepa] 67 5e-09 gb|AAR23522.1| mannose-binding lectin precursor [Allium cepa] 67 5e-09 dbj|BAD67184.1| mannose specific lectin [Dioscorea polystachya] 66 1e-08 gb|AAC37360.1| mannose specific lectin, partial [Allium ascaloni... 66 1e-08 gb|AIS22687.1| mannose-binding lectin, partial [Allium ascalonicum] 65 2e-08 gb|AAA16281.1| mannose-specific lectin, partial [Allium ursinum] 65 2e-08 dbj|BAJ10902.1| tuber lectin 1 [Dioscorea polystachya] 65 2e-08 dbj|BAP75575.1| mannose binding lectin [Allium fistulosum] 65 3e-08 dbj|BAP75574.1| mannose binding lectin [Allium fistulosum] 65 3e-08 gb|AIS22686.1| mannose-binding lectin, partial [Allium cepa] 65 3e-08 gb|ADN26577.1| agglutinin preproprotein [Allium altaicum] 65 3e-08 sp|P83886.3|ASAL_ALLSA RecName: Full=Mannose-specific lectin; Al... 64 3e-08 gb|ABB54692.1| mannose-binding insecticidal leaf lectin [Allium ... 64 3e-08 gb|AAY87143.1| mannose binding insecticidal lectin precursor [Ar... 64 3e-08 gb|AAW48531.1| mannose-binding insecticidal lectin, partial [All... 64 3e-08 gb|AHB72682.1| Cry1Ac::ASAL fusion protein [synthetic construct] 64 3e-08 gb|ABF72850.1| insecticidal mannose-binding seed lectin [Annona ... 64 3e-08 gb|ABF70332.1| lectin [Allium sativum] 64 3e-08 gb|AJD19687.1| mannose-binding lectin [Allium cepa] 64 4e-08 >gb|AAA19577.1| lectin [Epipactis helleborine] Length = 172 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = -1 Query: 404 SLGANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDTDSAV 243 S+ ++GNLV+ R +WASNT+R+NG Y L+L+KDRNVVIY +PIW T + + Sbjct: 80 SMQSDGNLVVYDVRNIAIWASNTARNNGNYLLILQKDRNVVIYSQPIWATTTNI 133 >gb|AAC37359.1| mannose specific lectin, partial [Allium cepa] Length = 164 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -1 Query: 395 ANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 A+GN V+ +GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 74 ADGNFVVYDVKGRAVWASNSRRGNGNYILVLQKDRNVVIYGSDIWST 120 >gb|AAR23522.1| mannose-binding lectin precursor [Allium cepa] Length = 110 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -1 Query: 395 ANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 A+GN V+ +GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 59 ADGNFVVYDVKGRAVWASNSRRGNGNYILVLQKDRNVVIYGSDIWST 105 >dbj|BAD67184.1| mannose specific lectin [Dioscorea polystachya] Length = 149 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = -1 Query: 407 CSLGANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDTDSAVV 240 C++ ++GNLV+ T + VWASNT+ NG Y L+L+KDRNVVIYG W T++ V Sbjct: 56 CAMQSDGNLVVYTSSNKAVWASNTNVGNGHYVLILQKDRNVVIYGGARWATNTNTV 111 >gb|AAC37360.1| mannose specific lectin, partial [Allium ascalonicum] Length = 177 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ +GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 86 DGNFVVYNVKGRAVWASNSRRGNGNYILVLQKDRNVVIYGSDIWST 131 >gb|AIS22687.1| mannose-binding lectin, partial [Allium ascalonicum] Length = 155 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ +GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 63 DGNFVVYDVKGRAVWASNSRRGNGNYILVLQKDRNVVIYGSDIWST 108 >gb|AAA16281.1| mannose-specific lectin, partial [Allium ursinum] Length = 185 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 395 ANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 A+GN V+ GR VWASN+ + NG Y LVL+KDRNVVIYG IW T Sbjct: 94 ADGNFVVYDSNGRAVWASNSRKGNGNYILVLQKDRNVVIYGSDIWST 140 >dbj|BAJ10902.1| tuber lectin 1 [Dioscorea polystachya] Length = 172 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = -1 Query: 407 CSLGANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDTDSAVV 240 C++ ++GNLV+ T VWASNT+ NG Y L+L+KDRNVVIYG W T++ V Sbjct: 79 CAMQSDGNLVVYTSNNNAVWASNTNVGNGHYVLILQKDRNVVIYGGARWATNTNTV 134 >dbj|BAP75575.1| mannose binding lectin [Allium fistulosum] Length = 177 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 395 ANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 A+GN V+ +GR VWASN+ R NG Y LVL++DRNVVIYG IW T Sbjct: 87 ADGNFVVYDFKGRAVWASNSRRGNGNYILVLQEDRNVVIYGSDIWST 133 >dbj|BAP75574.1| mannose binding lectin [Allium fistulosum] Length = 177 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 395 ANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 A+GN V+ GR VWASN+ R NG Y LVL++DRNVVIYG IW T Sbjct: 87 ADGNFVVYDVNGRAVWASNSRRGNGNYILVLQEDRNVVIYGSDIWST 133 >gb|AIS22686.1| mannose-binding lectin, partial [Allium cepa] Length = 146 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDTDSAVVKK 234 +GN V+ +GR VWASN+ R NG Y LVL+KDRNVV YG IW T + + K+ Sbjct: 62 DGNFVVYDVKGRAVWASNSRRGNGNYILVLQKDRNVVTYGSDIWSTGAYMKKE 114 >gb|ADN26577.1| agglutinin preproprotein [Allium altaicum] Length = 177 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 395 ANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 A+GN V+ +GR VWASN+ R NG Y LVL++DRNVVIYG IW T Sbjct: 87 ADGNFVVYDFKGRAVWASNSRRGNGNYILVLQEDRNVVIYGSDIWST 133 >sp|P83886.3|ASAL_ALLSA RecName: Full=Mannose-specific lectin; AltName: Full=ASAL; AltName: Full=ASARI; AltName: Full=Allimin; AltName: Full=Leaf agglutinin; AltName: Full=Root agglutinin; Flags: Precursor gi|1840049|gb|AAB64238.1| mannose-specific lectin [Allium sativum] Length = 181 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 90 DGNFVVYDVNGRPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWST 135 >gb|ABB54692.1| mannose-binding insecticidal leaf lectin [Allium cepa] Length = 110 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -1 Query: 395 ANGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIW 261 A+GN V+ GR VWASN+ R NG Y LVL+KDRNVVIYG IW Sbjct: 61 ADGNFVVYDVNGRPVWASNSRRGNGNYILVLQKDRNVVIYGSDIW 105 >gb|AAY87143.1| mannose binding insecticidal lectin precursor [Arum maculatum] gi|76496420|gb|ABA43714.1| mannose-binding leaf lectin [Amorphophallus paeoniifolius var. campanulatus] gi|168824096|gb|ACA30402.1| mannose-binding leaf lectin [Allium sativum] gi|169821647|gb|ACA96191.1| mannose binding rhizome lectin [Zingiber officinale] gi|238695884|gb|ACR55078.1| mannose-binding tuber agglutinin [Colocasia esculenta] Length = 112 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 62 DGNFVVYDVNGRPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWST 107 >gb|AAW48531.1| mannose-binding insecticidal lectin, partial [Allium sativum] Length = 120 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 62 DGNFVVYDVNGRPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWST 107 >gb|AHB72682.1| Cry1Ac::ASAL fusion protein [synthetic construct] Length = 487 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 434 DGNFVVYDVNGRPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWST 479 >gb|ABF72850.1| insecticidal mannose-binding seed lectin [Annona squamosa] Length = 112 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 62 DGNFVVYDVNGRPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWST 107 >gb|ABF70332.1| lectin [Allium sativum] Length = 181 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ GR VWASN+ R NG Y LVL+KDRNVVIYG IW T Sbjct: 90 DGNFVVYDVNGRPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWST 135 >gb|AJD19687.1| mannose-binding lectin [Allium cepa] Length = 111 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -1 Query: 392 NGNLVISTPRGRQVWASNTSRSNGEYALVLKKDRNVVIYGKPIWDT 255 +GN V+ +GR VWASN+ R NG Y LVL++DRNVVIYG IW T Sbjct: 61 DGNFVVYDVKGRAVWASNSRRGNGNYILVLQEDRNVVIYGSDIWST 106