BLASTX nr result
ID: Aconitum23_contig00029312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00029312 (366 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283258.1| PREDICTED: aspartic proteinase CDR1 [Vitis v... 57 5e-06 >ref|XP_002283258.1| PREDICTED: aspartic proteinase CDR1 [Vitis vinifera] gi|302142232|emb|CBI19435.3| unnamed protein product [Vitis vinifera] Length = 659 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/61 (44%), Positives = 41/61 (67%) Frame = -1 Query: 366 SWWDQHKTIVLGSIFGVFAVLAIGFALFGIWYVRKRRQQALGGTYRPVVSVGPEQELQKM 187 +WW+QH V + GV L +G + FG+W+V K RQ A+ GTY+P+ + PEQELQ++ Sbjct: 596 TWWEQHFWTV---VVGVIITLILGLSTFGVWFVWKWRQNAV-GTYKPIGARVPEQELQQL 651 Query: 186 S 184 + Sbjct: 652 T 652