BLASTX nr result
ID: Aconitum23_contig00029263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00029263 (358 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006404100.1| hypothetical protein EUTSA_v10010374mg [Eutr... 56 9e-06 >ref|XP_006404100.1| hypothetical protein EUTSA_v10010374mg [Eutrema salsugineum] gi|557105219|gb|ESQ45553.1| hypothetical protein EUTSA_v10010374mg [Eutrema salsugineum] Length = 447 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -3 Query: 275 QVLDLDTAVKGGVLGEEVDACVGVDEKYDLKKMVDELDLLDAPA 144 QVLDLDTAVK GVLG V+ VDEK DLKKM+ ELDL D P+ Sbjct: 22 QVLDLDTAVKDGVLGGGVNGGGVVDEKLDLKKMIKELDLQDIPS 65