BLASTX nr result
ID: Aconitum23_contig00028935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00028935 (647 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010483989.1| PREDICTED: YLP motif-containing protein 1-li... 67 9e-09 ref|XP_010444129.1| PREDICTED: uncharacterized protein LOC104726... 67 9e-09 ref|XP_002866509.1| hypothetical protein ARALYDRAFT_496458 [Arab... 65 3e-08 ref|NP_851250.1| P-loop containing nucleoside triphosphate hydro... 65 3e-08 gb|EMT24737.1| hypothetical protein F775_04815 [Aegilops tauschii] 58 5e-06 ref|XP_014508771.1| PREDICTED: uncharacterized protein LOC106768... 57 7e-06 ref|XP_014508770.1| PREDICTED: arginine-glutamic acid dipeptide ... 57 7e-06 ref|XP_006476648.1| PREDICTED: uncharacterized protein LOC102629... 57 9e-06 ref|XP_006439647.1| hypothetical protein CICLE_v10019215mg [Citr... 57 9e-06 >ref|XP_010483989.1| PREDICTED: YLP motif-containing protein 1-like isoform X2 [Camelina sativa] Length = 653 Score = 67.0 bits (162), Expect = 9e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 102 CWYVCLVLVDDRNLRIADFAQFWASAKRCGYEVY 1 CWY+ L+LVDDRNLR+ADFAQFWA+AKR GYE Y Sbjct: 382 CWYMSLILVDDRNLRVADFAQFWATAKRSGYEAY 415 >ref|XP_010444129.1| PREDICTED: uncharacterized protein LOC104726876 isoform X2 [Camelina sativa] Length = 653 Score = 67.0 bits (162), Expect = 9e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 102 CWYVCLVLVDDRNLRIADFAQFWASAKRCGYEVY 1 CWY+ L+LVDDRNLR+ADFAQFWA+AKR GYE Y Sbjct: 382 CWYMSLILVDDRNLRVADFAQFWATAKRSGYEAY 415 >ref|XP_002866509.1| hypothetical protein ARALYDRAFT_496458 [Arabidopsis lyrata subsp. lyrata] gi|297312344|gb|EFH42768.1| hypothetical protein ARALYDRAFT_496458 [Arabidopsis lyrata subsp. lyrata] Length = 650 Score = 65.5 bits (158), Expect = 3e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 102 CWYVCLVLVDDRNLRIADFAQFWASAKRCGYEVY 1 CWY+ L+LVDDRNLR+ADF QFWA+AKR GYE Y Sbjct: 388 CWYMSLILVDDRNLRVADFTQFWATAKRSGYEAY 421 >ref|NP_851250.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Arabidopsis thaliana] gi|332010268|gb|AED97651.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Arabidopsis thaliana] Length = 661 Score = 65.5 bits (158), Expect = 3e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 102 CWYVCLVLVDDRNLRIADFAQFWASAKRCGYEVY 1 CWY+ L+LVDDRNLR+ADF QFWA+AKR GYE Y Sbjct: 389 CWYMSLILVDDRNLRVADFTQFWATAKRSGYEAY 422 >gb|EMT24737.1| hypothetical protein F775_04815 [Aegilops tauschii] Length = 204 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 84 VLVDDRNLRIADFAQFWASAKRCGYEVY 1 V+VDDRNLRIADFAQFWASAKR GYEVY Sbjct: 158 VIVDDRNLRIADFAQFWASAKRSGYEVY 185 >ref|XP_014508771.1| PREDICTED: uncharacterized protein LOC106768250 isoform X2 [Vigna radiata var. radiata] Length = 694 Score = 57.4 bits (137), Expect = 7e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 87 LVLVDDRNLRIADFAQFWASAKRCGYEVY 1 L++VDDRNLR+ADFAQFWA+AKR GYEVY Sbjct: 421 LIIVDDRNLRVADFAQFWATAKRSGYEVY 449 >ref|XP_014508770.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein isoform X1 [Vigna radiata var. radiata] Length = 697 Score = 57.4 bits (137), Expect = 7e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 87 LVLVDDRNLRIADFAQFWASAKRCGYEVY 1 L++VDDRNLR+ADFAQFWA+AKR GYEVY Sbjct: 424 LIIVDDRNLRVADFAQFWATAKRSGYEVY 452 >ref|XP_006476648.1| PREDICTED: uncharacterized protein LOC102629941 [Citrus sinensis] Length = 657 Score = 57.0 bits (136), Expect = 9e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 87 LVLVDDRNLRIADFAQFWASAKRCGYEVY 1 +V+VDDRNLR+ADFAQFWA+AKR GYEVY Sbjct: 381 IVIVDDRNLRVADFAQFWATAKRSGYEVY 409 >ref|XP_006439647.1| hypothetical protein CICLE_v10019215mg [Citrus clementina] gi|557541909|gb|ESR52887.1| hypothetical protein CICLE_v10019215mg [Citrus clementina] Length = 658 Score = 57.0 bits (136), Expect = 9e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 87 LVLVDDRNLRIADFAQFWASAKRCGYEVY 1 +V+VDDRNLR+ADFAQFWA+AKR GYEVY Sbjct: 382 IVIVDDRNLRVADFAQFWATAKRSGYEVY 410