BLASTX nr result
ID: Aconitum23_contig00028920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00028920 (414 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006438761.1| hypothetical protein CICLE_v10032989mg [Citr... 92 1e-16 ref|XP_004239102.2| PREDICTED: protein UXT homolog [Solanum lyco... 92 2e-16 ref|XP_012067711.1| PREDICTED: protein UXT homolog [Jatropha cur... 92 2e-16 ref|XP_010682828.1| PREDICTED: protein UXT homolog [Beta vulgari... 91 3e-16 ref|XP_007045990.1| Prefoldin chaperone subunit family protein [... 91 3e-16 ref|XP_010258614.1| PREDICTED: protein UXT homolog [Nelumbo nuci... 91 4e-16 ref|XP_008462175.1| PREDICTED: protein UXT homolog [Cucumis melo] 91 4e-16 ref|XP_004141760.1| PREDICTED: protein UXT homolog [Cucumis sati... 91 4e-16 ref|XP_006572821.1| PREDICTED: uncharacterized protein LOC100499... 89 1e-15 ref|NP_001237769.1| uncharacterized protein LOC100499907 [Glycin... 89 1e-15 gb|KNA17587.1| hypothetical protein SOVF_078220 [Spinacia oleracea] 89 1e-15 ref|XP_009795700.1| PREDICTED: protein UXT homolog [Nicotiana sy... 89 1e-15 ref|XP_009624242.1| PREDICTED: protein UXT homolog [Nicotiana to... 89 1e-15 ref|XP_012448248.1| PREDICTED: protein UXT homolog isoform X2 [G... 89 2e-15 ref|XP_012448245.1| PREDICTED: protein UXT homolog isoform X1 [G... 89 2e-15 ref|XP_009356345.1| PREDICTED: protein UXT homolog [Pyrus x bret... 89 2e-15 ref|XP_008389434.1| PREDICTED: protein UXT homolog [Malus domest... 89 2e-15 ref|XP_011081895.1| PREDICTED: protein UXT homolog isoform X1 [S... 88 2e-15 gb|KRH70811.1| hypothetical protein GLYMA_02G111700 [Glycine max] 88 3e-15 gb|KHN01992.1| Protein UXT like [Glycine soja] 88 3e-15 >ref|XP_006438761.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|567892483|ref|XP_006438762.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|568859128|ref|XP_006483094.1| PREDICTED: protein UXT homolog isoform X1 [Citrus sinensis] gi|568859130|ref|XP_006483095.1| PREDICTED: protein UXT homolog isoform X2 [Citrus sinensis] gi|557540957|gb|ESR52001.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|557540958|gb|ESR52002.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|641864351|gb|KDO83037.1| hypothetical protein CISIN_1g0318872mg [Citrus sinensis] gi|641864352|gb|KDO83038.1| hypothetical protein CISIN_1g0318872mg [Citrus sinensis] gi|641864353|gb|KDO83039.1| hypothetical protein CISIN_1g0318872mg [Citrus sinensis] Length = 151 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD +EKVQ++EEFVDRRLKPDL RAIAERDKVFEQQKI+SDL++NIENLEK V Sbjct: 1 MDSYRQEKVQKFEEFVDRRLKPDLTRAIAERDKVFEQQKIFSDLRKNIENLEKNSV 56 >ref|XP_004239102.2| PREDICTED: protein UXT homolog [Solanum lycopersicum] Length = 184 Score = 92.0 bits (227), Expect = 2e-16 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD +EKV+R+EEF+DRRLKPDLV AIAERDKVFEQQKI+SDL+RNIENLEK +V Sbjct: 39 MDTIKQEKVRRFEEFIDRRLKPDLVHAIAERDKVFEQQKIFSDLRRNIENLEKNNV 94 >ref|XP_012067711.1| PREDICTED: protein UXT homolog [Jatropha curcas] gi|643734578|gb|KDP41248.1| hypothetical protein JCGZ_15655 [Jatropha curcas] Length = 151 Score = 91.7 bits (226), Expect = 2e-16 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 M+ +EKVQ++EEFVDRRLKPDLVRAIAERDKVFEQQKI+SDL+ NIENLEK V Sbjct: 1 MENYRQEKVQKFEEFVDRRLKPDLVRAIAERDKVFEQQKIFSDLRNNIENLEKNSV 56 >ref|XP_010682828.1| PREDICTED: protein UXT homolog [Beta vulgaris subsp. vulgaris] gi|731343307|ref|XP_010682830.1| PREDICTED: protein UXT homolog [Beta vulgaris subsp. vulgaris] gi|731343309|ref|XP_010682831.1| PREDICTED: protein UXT homolog [Beta vulgaris subsp. vulgaris] gi|731343311|ref|XP_010682832.1| PREDICTED: protein UXT homolog [Beta vulgaris subsp. vulgaris] gi|731343313|ref|XP_010682833.1| PREDICTED: protein UXT homolog [Beta vulgaris subsp. vulgaris] gi|731343315|ref|XP_010682834.1| PREDICTED: protein UXT homolog [Beta vulgaris subsp. vulgaris] gi|870855791|gb|KMT07507.1| hypothetical protein BVRB_6g151210 [Beta vulgaris subsp. vulgaris] gi|870855794|gb|KMT07510.1| hypothetical protein BVRB_6g151240 [Beta vulgaris subsp. vulgaris] Length = 143 Score = 91.3 bits (225), Expect = 3e-16 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MDK EEKV+++EEFVDRRLKPDLV+AIAERDKVFEQQK +SDLK NI+NLEK V Sbjct: 1 MDKYKEEKVKKFEEFVDRRLKPDLVKAIAERDKVFEQQKTFSDLKMNIQNLEKNSV 56 >ref|XP_007045990.1| Prefoldin chaperone subunit family protein [Theobroma cacao] gi|508709925|gb|EOY01822.1| Prefoldin chaperone subunit family protein [Theobroma cacao] Length = 363 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 M+ EK+Q++EEFVDRRLKPDLVRAIAERDKVFEQQKI+SDL++NIENLEK V Sbjct: 1 MESLRHEKIQKFEEFVDRRLKPDLVRAIAERDKVFEQQKIFSDLRKNIENLEKNSV 56 >ref|XP_010258614.1| PREDICTED: protein UXT homolog [Nelumbo nucifera] gi|719966330|ref|XP_010258622.1| PREDICTED: protein UXT homolog [Nelumbo nucifera] Length = 146 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD EKVQ++EEFVDRRLKPDLVRAI ERDKVFEQQK+YSDLKR+I+NLEK V Sbjct: 1 MDNIRVEKVQKFEEFVDRRLKPDLVRAIVERDKVFEQQKVYSDLKRSIQNLEKNGV 56 >ref|XP_008462175.1| PREDICTED: protein UXT homolog [Cucumis melo] Length = 155 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +1 Query: 250 DKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 D EKVQR+EEFVDRRLKPDLV AIAERDKVFEQQK++SDL+RNIENLEK + Sbjct: 6 DSFRNEKVQRFEEFVDRRLKPDLVHAIAERDKVFEQQKVFSDLRRNIENLEKNSI 60 >ref|XP_004141760.1| PREDICTED: protein UXT homolog [Cucumis sativus] gi|700190160|gb|KGN45393.1| hypothetical protein Csa_7G447080 [Cucumis sativus] Length = 155 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +1 Query: 250 DKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 D EKVQR+EEFVDRRLKPDLV AIAERDKVFEQQK++SDL+RNIENLEK + Sbjct: 6 DNFRHEKVQRFEEFVDRRLKPDLVHAIAERDKVFEQQKVFSDLRRNIENLEKNSI 60 >ref|XP_006572821.1| PREDICTED: uncharacterized protein LOC100499907 isoform X2 [Glycine max] Length = 136 Score = 89.4 bits (220), Expect = 1e-15 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD +EKVQR+EEFVD+RLKPDLV AIA+RDKVFEQQKI++DL++NIENLEK V Sbjct: 1 MDSLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFTDLRKNIENLEKNSV 56 >ref|NP_001237769.1| uncharacterized protein LOC100499907 [Glycine max] gi|571433258|ref|XP_006572820.1| PREDICTED: uncharacterized protein LOC100499907 isoform X1 [Glycine max] gi|255627579|gb|ACU14134.1| unknown [Glycine max] gi|734421725|gb|KHN41370.1| Protein UXT like [Glycine soja] gi|947127088|gb|KRH74942.1| hypothetical protein GLYMA_01G053200 [Glycine max] Length = 151 Score = 89.4 bits (220), Expect = 1e-15 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD +EKVQR+EEFVD+RLKPDLV AIA+RDKVFEQQKI++DL++NIENLEK V Sbjct: 1 MDSLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFTDLRKNIENLEKNSV 56 >gb|KNA17587.1| hypothetical protein SOVF_078220 [Spinacia oleracea] Length = 142 Score = 89.0 bits (219), Expect = 1e-15 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 M +N E KV+++EEFVDRRLKPDLV+AIAERDK+FEQQK +SDLKRNI+NLEK V Sbjct: 1 MGENKEAKVKKFEEFVDRRLKPDLVKAIAERDKLFEQQKTFSDLKRNIQNLEKNSV 56 >ref|XP_009795700.1| PREDICTED: protein UXT homolog [Nicotiana sylvestris] gi|698499812|ref|XP_009795702.1| PREDICTED: protein UXT homolog [Nicotiana sylvestris] gi|698499814|ref|XP_009795703.1| PREDICTED: protein UXT homolog [Nicotiana sylvestris] Length = 146 Score = 89.0 bits (219), Expect = 1e-15 Identities = 44/56 (78%), Positives = 48/56 (85%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD EKV+R+EEFVDRRLKPDLV AIAERDKVFEQQKI+SDL+ NIENLEK V Sbjct: 1 MDTIKHEKVRRFEEFVDRRLKPDLVHAIAERDKVFEQQKIFSDLRSNIENLEKNSV 56 >ref|XP_009624242.1| PREDICTED: protein UXT homolog [Nicotiana tomentosiformis] gi|697140293|ref|XP_009624243.1| PREDICTED: protein UXT homolog [Nicotiana tomentosiformis] gi|697140295|ref|XP_009624244.1| PREDICTED: protein UXT homolog [Nicotiana tomentosiformis] gi|697140297|ref|XP_009624245.1| PREDICTED: protein UXT homolog [Nicotiana tomentosiformis] Length = 146 Score = 89.0 bits (219), Expect = 1e-15 Identities = 44/56 (78%), Positives = 48/56 (85%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD EKV+R+EEFVDRRLKPDLV AIAERDKVFEQQKI+SDL+ NIENLEK V Sbjct: 1 MDTIKHEKVRRFEEFVDRRLKPDLVHAIAERDKVFEQQKIFSDLRSNIENLEKNSV 56 >ref|XP_012448248.1| PREDICTED: protein UXT homolog isoform X2 [Gossypium raimondii] Length = 137 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/56 (71%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD +EK+Q++EEFVDRRLKPD+V AIAERDK+F+QQKI+SDL++NIENLEK V Sbjct: 1 MDSLRQEKIQKFEEFVDRRLKPDVVHAIAERDKIFDQQKIFSDLRKNIENLEKNSV 56 >ref|XP_012448245.1| PREDICTED: protein UXT homolog isoform X1 [Gossypium raimondii] gi|823231072|ref|XP_012448246.1| PREDICTED: protein UXT homolog isoform X1 [Gossypium raimondii] gi|823231074|ref|XP_012448247.1| PREDICTED: protein UXT homolog isoform X1 [Gossypium raimondii] gi|763793785|gb|KJB60781.1| hypothetical protein B456_009G325600 [Gossypium raimondii] gi|763793787|gb|KJB60783.1| hypothetical protein B456_009G325600 [Gossypium raimondii] gi|763793788|gb|KJB60784.1| hypothetical protein B456_009G325600 [Gossypium raimondii] gi|763793789|gb|KJB60785.1| hypothetical protein B456_009G325600 [Gossypium raimondii] Length = 151 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/56 (71%), Positives = 50/56 (89%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD +EK+Q++EEFVDRRLKPD+V AIAERDK+F+QQKI+SDL++NIENLEK V Sbjct: 1 MDSLRQEKIQKFEEFVDRRLKPDVVHAIAERDKIFDQQKIFSDLRKNIENLEKNSV 56 >ref|XP_009356345.1| PREDICTED: protein UXT homolog [Pyrus x bretschneideri] Length = 157 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/56 (71%), Positives = 51/56 (91%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD + + K+Q++EEFVD+RLKPDLVRAIA+RDKVFEQQK++SDL++NIENLEK V Sbjct: 1 MDISRQNKIQKFEEFVDQRLKPDLVRAIAQRDKVFEQQKVFSDLRKNIENLEKNSV 56 >ref|XP_008389434.1| PREDICTED: protein UXT homolog [Malus domestica] Length = 152 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/56 (71%), Positives = 51/56 (91%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD + + K+Q++EEFVD+RLKPDLVRAIA+RDKVFEQQK++SDL++NIENLEK V Sbjct: 1 MDISRQNKIQKFEEFVDQRLKPDLVRAIAQRDKVFEQQKVFSDLRKNIENLEKNSV 56 >ref|XP_011081895.1| PREDICTED: protein UXT homolog isoform X1 [Sesamum indicum] Length = 145 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD + K++++EEFVDRRLKPDLV AIA+RDKVFEQQKI+SDL+RNIENLEK V Sbjct: 1 MDSAKQNKIRKFEEFVDRRLKPDLVHAIAQRDKVFEQQKIFSDLRRNIENLEKNSV 56 >gb|KRH70811.1| hypothetical protein GLYMA_02G111700 [Glycine max] Length = 128 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD +EKVQR+EEFVD+RLKPDLV AIA+RDKVFEQQKI++DL +NIENLEK V Sbjct: 1 MDNLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFADLGKNIENLEKNSV 56 >gb|KHN01992.1| Protein UXT like [Glycine soja] Length = 228 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = +1 Query: 247 MDKNTEEKVQRYEEFVDRRLKPDLVRAIAERDKVFEQQKIYSDLKRNIENLEKKDV 414 MD +EKVQR+EEFVD+RLKPDLV AIA+RDKVFEQQKI++DL +NIENLEK V Sbjct: 78 MDNLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFADLGKNIENLEKNSV 133