BLASTX nr result
ID: Aconitum23_contig00028857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00028857 (617 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097843.1| PREDICTED: uncharacterized protein LOC105176... 58 5e-06 >ref|XP_011097843.1| PREDICTED: uncharacterized protein LOC105176667 [Sesamum indicum] gi|747099576|ref|XP_011097844.1| PREDICTED: uncharacterized protein LOC105176667 [Sesamum indicum] gi|747099578|ref|XP_011097845.1| PREDICTED: uncharacterized protein LOC105176667 [Sesamum indicum] Length = 108 Score = 57.8 bits (138), Expect = 5e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 617 TEEMFKARKQKEAIHRAIRPPLIISHDPVPTPDSS 513 TEEM+ ARKQKEA HRA+RPPL+++H P PT D+S Sbjct: 73 TEEMYNARKQKEANHRALRPPLVVNHHPAPTSDAS 107