BLASTX nr result
ID: Aconitum23_contig00028776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00028776 (499 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010658658.1| PREDICTED: cucumisin [Vitis vinifera] 57 7e-06 emb|CBI31596.3| unnamed protein product [Vitis vinifera] 57 7e-06 >ref|XP_010658658.1| PREDICTED: cucumisin [Vitis vinifera] Length = 1430 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +2 Query: 353 ESLDKSLVHSKIVLCDKLNGGEGKMAAGAVCTAIQDVGFSDVAFAFGEP 499 +SLDKSLV KIVLCD L G+ +AAGAV T +QD G+SD A+ + P Sbjct: 1074 DSLDKSLVDGKIVLCDWLTSGKAAIAAGAVGTVMQDGGYSDSAYIYALP 1122 >emb|CBI31596.3| unnamed protein product [Vitis vinifera] Length = 697 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +2 Query: 353 ESLDKSLVHSKIVLCDKLNGGEGKMAAGAVCTAIQDVGFSDVAFAFGEP 499 +SLDKSLV KIVLCD L G+ +AAGAV T +QD G+SD A+ + P Sbjct: 347 DSLDKSLVDGKIVLCDWLTSGKAAIAAGAVGTVMQDGGYSDSAYIYALP 395