BLASTX nr result
ID: Aconitum23_contig00028301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00028301 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN25439.1| Diphthamide biosynthesis protein 1 [Glycine soja] 57 5e-06 ref|XP_006592079.1| PREDICTED: diphthamide biosynthesis protein ... 57 5e-06 >gb|KHN25439.1| Diphthamide biosynthesis protein 1 [Glycine soja] Length = 381 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/54 (46%), Positives = 32/54 (59%) Frame = -3 Query: 164 LVPSPNATSDKPRPTPKRFIKNQIPDXXXXXXXXXXXXXXXXXNYNFEVHKCVW 3 ++PS +++P+P PKRF+KNQIPD NYNFEVHKCVW Sbjct: 11 VLPSEQPNNNRPKPKPKRFVKNQIPDSILNNPLLSAAISVLPSNYNFEVHKCVW 64 >ref|XP_006592079.1| PREDICTED: diphthamide biosynthesis protein 1-like [Glycine max] gi|947075511|gb|KRH24351.1| hypothetical protein GLYMA_12G035900 [Glycine max] Length = 462 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/54 (46%), Positives = 32/54 (59%) Frame = -3 Query: 164 LVPSPNATSDKPRPTPKRFIKNQIPDXXXXXXXXXXXXXXXXXNYNFEVHKCVW 3 ++PS +++P+P PKRF+KNQIPD NYNFEVHKCVW Sbjct: 11 VLPSEQPNNNRPKPKPKRFVKNQIPDSILNNPLLSAAISVLPSNYNFEVHKCVW 64