BLASTX nr result
ID: Aconitum23_contig00028077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00028077 (410 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510983.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 >ref|XP_002510983.1| conserved hypothetical protein [Ricinus communis] gi|223550098|gb|EEF51585.1| conserved hypothetical protein [Ricinus communis] Length = 323 Score = 57.4 bits (137), Expect = 4e-06 Identities = 37/117 (31%), Positives = 61/117 (52%), Gaps = 11/117 (9%) Frame = -3 Query: 351 KMSIFSLQTRQVDVLDLHLVNPISADSCLTHLVFGNGLLYATSQDGHLLKFDIKQPSV-- 178 ++ +FS ++ + L L + +S ++ G +Y S+ GH++KF I + V Sbjct: 158 RLLVFSSKSWSWNPLKYELQDVLSILRWDKESIYFCGAIYKLSKSGHVVKFSIDEEKVAS 217 Query: 177 ---RAIELPKRYGEFGCIGMSQGRLHFAWDDNKTKMMVWVLHD------EWILKYAL 34 RAI+LPK E C G+S G LH+A D+ + +WVL+ EW+LKY + Sbjct: 218 DRVRAIKLPKYAPEMRCYGVSNGSLHYANVDD-GNLQIWVLNGSIGDECEWVLKYTV 273