BLASTX nr result
ID: Aconitum23_contig00027648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00027648 (336 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010269530.1| PREDICTED: 60S ribosomal protein L7-2 [Nelum... 67 5e-09 ref|XP_012074809.1| PREDICTED: 60S ribosomal protein L7-2-like [... 67 5e-09 ref|XP_002517516.1| 60S ribosomal protein L7, putative [Ricinus ... 66 1e-08 ref|XP_002524137.1| 60S ribosomal protein L7, putative [Ricinus ... 66 1e-08 gb|ACN40686.1| unknown [Picea sitchensis] 65 2e-08 gb|ABK26757.1| unknown [Picea sitchensis] gi|224286296|gb|ACN408... 65 2e-08 gb|ABK23069.1| unknown [Picea sitchensis] 65 2e-08 gb|ABK22465.1| unknown [Picea sitchensis] gi|116793107|gb|ABK266... 65 2e-08 ref|XP_012089003.1| PREDICTED: 60S ribosomal protein L7-2-like [... 65 2e-08 ref|XP_014499709.1| PREDICTED: 60S ribosomal protein L7-4 [Vigna... 65 3e-08 dbj|BAT04445.1| Os08g0234000 [Oryza sativa Japonica Group] 65 3e-08 ref|NP_001061310.1| Os08g0234000 [Oryza sativa Japonica Group] g... 65 3e-08 ref|XP_011626987.1| PREDICTED: 60S ribosomal protein L7-2 isofor... 65 3e-08 ref|XP_011094120.1| PREDICTED: 60S ribosomal protein L7-2-like [... 65 3e-08 ref|XP_011077741.1| PREDICTED: 60S ribosomal protein L7-2-like [... 65 3e-08 ref|XP_011072736.1| PREDICTED: 60S ribosomal protein L7-4-like i... 65 3e-08 ref|XP_011072735.1| PREDICTED: 60S ribosomal protein L7-4-like i... 65 3e-08 ref|XP_011020071.1| PREDICTED: 60S ribosomal protein L7-3-like [... 65 3e-08 ref|XP_010276711.1| PREDICTED: 60S ribosomal protein L7-2-like [... 65 3e-08 ref|XP_009382840.1| PREDICTED: 60S ribosomal protein L7-2-like [... 65 3e-08 >ref|XP_010269530.1| PREDICTED: 60S ribosomal protein L7-2 [Nelumbo nucifera] Length = 246 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 PS GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 214 PSGGLKKKRNHYVEGGDAGNREDYINELIRRMN 246 >ref|XP_012074809.1| PREDICTED: 60S ribosomal protein L7-2-like [Jatropha curcas] gi|643726957|gb|KDP35522.1| hypothetical protein JCGZ_08960 [Jatropha curcas] Length = 245 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 PS GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 213 PSGGLKKKRNHYVEGGDAGNREDYINELIRRMN 245 >ref|XP_002517516.1| 60S ribosomal protein L7, putative [Ricinus communis] gi|223543527|gb|EEF45058.1| 60S ribosomal protein L7, putative [Ricinus communis] Length = 243 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P +GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 211 PLEGLKKKRNHYVEGGDAGNREDYINELIRRMN 243 >ref|XP_002524137.1| 60S ribosomal protein L7, putative [Ricinus communis] gi|223536604|gb|EEF38248.1| 60S ribosomal protein L7, putative [Ricinus communis] Length = 243 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P +GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 211 PLEGLKKKRNHYVEGGDAGNREDYINELIRRMN 243 >gb|ACN40686.1| unknown [Picea sitchensis] Length = 246 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 PS GLKKKRNHY+EGGDAGNRE KINELIRRMN Sbjct: 214 PSGGLKKKRNHYIEGGDAGNRELKINELIRRMN 246 >gb|ABK26757.1| unknown [Picea sitchensis] gi|224286296|gb|ACN40856.1| unknown [Picea sitchensis] Length = 246 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 PS GLKKKRNHY+EGGDAGNRE KINELIRRMN Sbjct: 214 PSGGLKKKRNHYIEGGDAGNRELKINELIRRMN 246 >gb|ABK23069.1| unknown [Picea sitchensis] Length = 246 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 PS GLKKKRNHY+EGGDAGNRE KINELIRRMN Sbjct: 214 PSGGLKKKRNHYIEGGDAGNRELKINELIRRMN 246 >gb|ABK22465.1| unknown [Picea sitchensis] gi|116793107|gb|ABK26616.1| unknown [Picea sitchensis] Length = 246 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 PS GLKKKRNHY+EGGDAGNRE KINELIRRMN Sbjct: 214 PSGGLKKKRNHYIEGGDAGNRELKINELIRRMN 246 >ref|XP_012089003.1| PREDICTED: 60S ribosomal protein L7-2-like [Jatropha curcas] gi|802756276|ref|XP_012089005.1| PREDICTED: 60S ribosomal protein L7-2-like [Jatropha curcas] gi|643708560|gb|KDP23476.1| hypothetical protein JCGZ_23309 [Jatropha curcas] Length = 245 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 PS GLKKKRNHYVEGGDAGNRE+ INELIRRMN Sbjct: 213 PSGGLKKKRNHYVEGGDAGNRENYINELIRRMN 245 >ref|XP_014499709.1| PREDICTED: 60S ribosomal protein L7-4 [Vigna radiata var. radiata] Length = 244 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 212 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 244 >dbj|BAT04445.1| Os08g0234000 [Oryza sativa Japonica Group] Length = 117 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 85 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 117 >ref|NP_001061310.1| Os08g0234000 [Oryza sativa Japonica Group] gi|38637548|dbj|BAD03800.1| putative 60S ribosomal protein L7 [Oryza sativa Japonica Group] gi|113623279|dbj|BAF23224.1| Os08g0234000 [Oryza sativa Japonica Group] gi|125560652|gb|EAZ06100.1| hypothetical protein OsI_28337 [Oryza sativa Indica Group] gi|215736831|dbj|BAG95760.1| unnamed protein product [Oryza sativa Japonica Group] gi|937929528|dbj|BAT04444.1| Os08g0234000 [Oryza sativa Japonica Group] Length = 245 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 213 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 245 >ref|XP_011626987.1| PREDICTED: 60S ribosomal protein L7-2 isoform X1 [Amborella trichopoda] Length = 288 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 256 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 288 >ref|XP_011094120.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum] gi|747092690|ref|XP_011094121.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum] Length = 244 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 212 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 244 >ref|XP_011077741.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum] gi|747062459|ref|XP_011077742.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum] gi|747062461|ref|XP_011077743.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum] Length = 245 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 213 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 245 >ref|XP_011072736.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X2 [Sesamum indicum] Length = 243 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 211 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 243 >ref|XP_011072735.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X1 [Sesamum indicum] Length = 248 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 216 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 248 >ref|XP_011020071.1| PREDICTED: 60S ribosomal protein L7-3-like [Populus euphratica] gi|743816013|ref|XP_011020073.1| PREDICTED: 60S ribosomal protein L7-3-like [Populus euphratica] Length = 244 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 212 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 244 >ref|XP_010276711.1| PREDICTED: 60S ribosomal protein L7-2-like [Nelumbo nucifera] Length = 246 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 214 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 246 >ref|XP_009382840.1| PREDICTED: 60S ribosomal protein L7-2-like [Musa acuminata subsp. malaccensis] Length = 244 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 334 PSDGLKKKRNHYVEGGDAGNREDKINELIRRMN 236 P GLKKKRNHYVEGGDAGNRED INELIRRMN Sbjct: 212 PLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 244