BLASTX nr result
ID: Aconitum23_contig00027494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00027494 (391 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219414.1| hypothetical protein PRUPE_ppa021915mg, part... 44 6e-06 >ref|XP_007219414.1| hypothetical protein PRUPE_ppa021915mg, partial [Prunus persica] gi|462415876|gb|EMJ20613.1| hypothetical protein PRUPE_ppa021915mg, partial [Prunus persica] Length = 509 Score = 44.3 bits (103), Expect(2) = 6e-06 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 5/82 (6%) Frame = +3 Query: 150 KQETNFFFEVVPINPIQILNSSME--NSQIYRNLWDP---DFTSAPKVVSWTPPPENFLK 314 K F E ++PI +L+ +M N I N+ D+ + +WTPP + F+K Sbjct: 354 KARCKFVIEGRQLHPIHVLHQAMRAANEFIEANVSQSTHSDYVTLISTRAWTPPSDGFVK 413 Query: 315 LNTDASRDPNSNISHAGWVIRN 380 +NTDA+ SN S G VIR+ Sbjct: 414 VNTDAAWIKESNRSAVGVVIRD 435 Score = 32.3 bits (72), Expect(2) = 6e-06 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 44 ENQLNIWDQLQTKFVNSEDQTYLTSFIAHLLWDIWKARNKF 166 +N LN Q + D+ L + I+ +LW+IWKAR KF Sbjct: 321 DNWLN--SMFQLNLTSILDRNRLMTIISFILWEIWKARCKF 359