BLASTX nr result
ID: Aconitum23_contig00027218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00027218 (327 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013449028.1| hypothetical protein MTR_7g065810 [Medicago ... 60 8e-07 >ref|XP_013449028.1| hypothetical protein MTR_7g065810 [Medicago truncatula] gi|657378269|gb|KEH23055.1| hypothetical protein MTR_7g065810 [Medicago truncatula] Length = 387 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 1/76 (1%) Frame = +2 Query: 62 KVGNGAKVLFWGDKWVSETPLATRFKRIHKWADNPMSTI-ENHVRIQEDGTLVWSLNLRR 238 +VG+G+ LFW D+W+ E PL RF R+ A N +ST+ E H E+G + W RR Sbjct: 192 RVGDGSNTLFWHDRWLGEVPLCKRFTRLFDLASNKLSTVAEMHTLGWEEGGVAW--RWRR 249 Query: 239 RRWAPELQMELDELHN 286 R W P Q + + N Sbjct: 250 RLWRPAQQRKQQKERN 265