BLASTX nr result
ID: Aconitum23_contig00025934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025934 (603 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 49 1e-09 ref|YP_588321.1| hypothetical protein ZeamMp058 (mitochondrion) ... 46 1e-08 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 48.5 bits (114), Expect(2) = 1e-09 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = +1 Query: 154 LRWSS--LIFPNVQSCSGLRKEHRPSALNE 237 +RWSS + FPNV+SCSGLRKEHRPS LNE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 Score = 41.6 bits (96), Expect(2) = 1e-09 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 51 MLLPADQAATLLVIGVSGLPLTFGSDKSSPLGRFAQV 161 MLLPA AA +S PL+FGSDKSSP GRFAQV Sbjct: 1 MLLPASDAAR---DRLSFKPLSFGSDKSSPFGRFAQV 34 >ref|YP_588321.1| hypothetical protein ZeamMp058 (mitochondrion) [Zea mays subsp. mays] gi|40795110|gb|AAR91154.1| hypothetical protein (mitochondrion) [Zea mays] gi|413954039|gb|AFW86688.1| putative uncharacterized protein orf109-a [Zea mays] gi|413954253|gb|AFW86902.1| putative uncharacterized protein orf109-a [Zea mays] gi|414888179|tpg|DAA64193.1| TPA: putative uncharacterized protein orf109-a [Zea mays] Length = 109 Score = 45.8 bits (107), Expect(2) = 1e-08 Identities = 28/62 (45%), Positives = 29/62 (46%) Frame = +1 Query: 298 MSITHRRLVRTEGQCPPNLXXXXXXXXXXXXXXXXXXXVQRPRSRKRQLSFERKRSHPRR 477 MSITH RLVRTEGQCPP VQ PR R+LSF KR P Sbjct: 1 MSITHLRLVRTEGQCPPR----RAHQRSNCYLIGRFAFVQGPRCWNRRLSFSSKRPTPEG 56 Query: 478 AP 483 P Sbjct: 57 RP 58 Score = 40.4 bits (93), Expect(2) = 1e-08 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 464 PTPEGRPRSLGKTLRKNNV 520 PTPEGRPRS+GKTLRK NV Sbjct: 52 PTPEGRPRSIGKTLRKKNV 70