BLASTX nr result
ID: Aconitum23_contig00025762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025762 (311 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010109748.1| hypothetical protein L484_000735 [Morus nota... 58 3e-06 >ref|XP_010109748.1| hypothetical protein L484_000735 [Morus notabilis] gi|587972331|gb|EXC57185.1| hypothetical protein L484_000735 [Morus notabilis] Length = 692 Score = 57.8 bits (138), Expect = 3e-06 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 3/106 (2%) Frame = +1 Query: 1 GQVVAIDLGNQGPKLLQVMPPVTIFDQA-IKAYLVEDLSGDLLLVSKNVKNLPEEEGWYV 177 G + + D+ N + ++ P D + +K YLVE G LL V +++ E++G Sbjct: 173 GVLRSFDVTNPCNPTVNLVAPRRASDHSSVKRYLVESYGGKLLQVERHLSWRNEDDGRET 232 Query: 178 --LTVHKLDLVQGKWIKIRNLGNSVLFLGMNGSIARSLSDCPGCQP 309 V +LD + KWIKI++LG+ LFLG N SI+ S+ GC+P Sbjct: 233 KRFRVFRLDFDRAKWIKIKSLGDVSLFLGDNSSISVLASNFIGCEP 278