BLASTX nr result
ID: Aconitum23_contig00025729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025729 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011458091.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 57 5e-06 ref|XP_004290060.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 >ref|XP_011458091.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 isoform X2 [Fragaria vesca subsp. vesca] Length = 871 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 5/52 (9%) Frame = -3 Query: 255 VTKVLLNNAKNPSFSWHFFKHLLSSPAS-----SSFHKSIPTITRILISSQM 115 +TK L NN NP +WH FK +LSSP S SS H S+P I RILISS+M Sbjct: 6 LTKALHNNTNNPKLAWHLFKRILSSPTSTSTSTSSSHLSLPIIARILISSKM 57 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -3 Query: 258 RVTKVLLNNAKNPSFSWHFFKHLLSSPASSSFH-KSIPTITRILISSQM 115 ++TK LLNNA NP +WH FK +LS P SS+ +SIP I+RILI S+M Sbjct: 6 KLTKALLNNAHNPKLAWHLFKRILSLPISSNHRSQSIPIISRILIRSKM 54 >ref|XP_004290060.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 isoform X1 [Fragaria vesca subsp. vesca] Length = 871 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 5/52 (9%) Frame = -3 Query: 255 VTKVLLNNAKNPSFSWHFFKHLLSSPAS-----SSFHKSIPTITRILISSQM 115 +TK L NN NP +WH FK +LSSP S SS H S+P I RILISS+M Sbjct: 6 LTKALHNNTNNPKLAWHLFKRILSSPTSTSTSTSSSHLSLPIIARILISSKM 57