BLASTX nr result
ID: Aconitum23_contig00025595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025595 (335 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518058.1| conserved hypothetical protein [Ricinus comm... 56 9e-06 >ref|XP_002518058.1| conserved hypothetical protein [Ricinus communis] gi|223542654|gb|EEF44191.1| conserved hypothetical protein [Ricinus communis] Length = 2833 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/45 (53%), Positives = 38/45 (84%) Frame = -1 Query: 335 YSIAHVFLASSNNAKVTVFRNPVRLCQQGSTLRLAILMPKNQEDT 201 +SIAHVFL+S+N+A+VT+FRNPV+ CQ G L+L ++MP ++++ Sbjct: 2786 FSIAHVFLSSNNSARVTIFRNPVKQCQAGK-LQLVVMMPNQKKES 2829