BLASTX nr result
ID: Aconitum23_contig00025589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025589 (539 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258825.1| PREDICTED: putative disease resistance prote... 57 1e-08 >ref|XP_010258825.1| PREDICTED: putative disease resistance protein At1g50180 [Nelumbo nucifera] Length = 850 Score = 57.4 bits (137), Expect(2) = 1e-08 Identities = 31/65 (47%), Positives = 43/65 (66%) Frame = +1 Query: 82 EHCNNTFREDVNLLLGVEGEITLLQDEFRFIGSFLRDADKKRKRSNFA*VGGQQIREVA* 261 E+ ++ + NLLLGV+ +I L DE +I SFLRDAD+KRK+ V QIR++A Sbjct: 11 ENLSSLLTREANLLLGVDEQIRSLHDELEWIRSFLRDADQKRKKYERVKVWVSQIRDLAY 70 Query: 262 DAEEI 276 DAE+I Sbjct: 71 DAEDI 75 Score = 28.5 bits (62), Expect(2) = 1e-08 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 357 HRIGKQIEKSNTRLQKIS 410 H++GKQIE+ N R++K+S Sbjct: 111 HKVGKQIEEINRRVEKVS 128