BLASTX nr result
ID: Aconitum23_contig00025509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025509 (463 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014510039.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Vi... 56 9e-06 >ref|XP_014510039.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Vigna radiata var. radiata] gi|920681593|gb|KOM28380.1| hypothetical protein LR48_Vigan541s000300 [Vigna angularis] Length = 431 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = -1 Query: 463 RPTTDLETGLRKFVKWYLSYYGYN-GKIVN 377 +PTTDL+TGL+KFVKWYLSYYGYN GK VN Sbjct: 402 KPTTDLQTGLKKFVKWYLSYYGYNHGKSVN 431