BLASTX nr result
ID: Aconitum23_contig00025396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025396 (602 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013469455.1| armadillo/beta-catenin repeat protein [Medic... 56 8e-07 ref|XP_013469454.1| armadillo/beta-catenin repeat protein [Medic... 56 8e-07 gb|KNA11442.1| hypothetical protein SOVF_135140 [Spinacia oleracea] 55 2e-06 ref|XP_011041060.1| PREDICTED: U-box domain-containing protein 1... 58 4e-06 ref|XP_011024385.1| PREDICTED: U-box domain-containing protein 1... 58 4e-06 ref|XP_012080958.1| PREDICTED: U-box domain-containing protein 1... 57 1e-05 ref|XP_012834964.1| PREDICTED: U-box domain-containing protein 1... 57 1e-05 >ref|XP_013469455.1| armadillo/beta-catenin repeat protein [Medicago truncatula] gi|657404892|gb|KEH43493.1| armadillo/beta-catenin repeat protein [Medicago truncatula] Length = 630 Score = 55.8 bits (133), Expect(2) = 8e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 104 KVATGQADPVPVLIEVIRTGYPHNGENAAAVLWL 3 + A GQA+P+P+L+EVIRTG P N ENAAAVLWL Sbjct: 542 RTAIGQAEPIPILVEVIRTGSPRNRENAAAVLWL 575 Score = 24.3 bits (51), Expect(2) = 8e-07 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 148 ETLAVLTIIASQREGR 101 E LA+LTI+A EGR Sbjct: 527 EALAILTILAGHHEGR 542 >ref|XP_013469454.1| armadillo/beta-catenin repeat protein [Medicago truncatula] gi|657404891|gb|KEH43492.1| armadillo/beta-catenin repeat protein [Medicago truncatula] Length = 447 Score = 55.8 bits (133), Expect(2) = 8e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 104 KVATGQADPVPVLIEVIRTGYPHNGENAAAVLWL 3 + A GQA+P+P+L+EVIRTG P N ENAAAVLWL Sbjct: 359 RTAIGQAEPIPILVEVIRTGSPRNRENAAAVLWL 392 Score = 24.3 bits (51), Expect(2) = 8e-07 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 148 ETLAVLTIIASQREGR 101 E LA+LTI+A EGR Sbjct: 344 EALAILTILAGHHEGR 359 >gb|KNA11442.1| hypothetical protein SOVF_135140 [Spinacia oleracea] Length = 632 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 104 KVATGQADPVPVLIEVIRTGYPHNGENAAAVLW 6 K+A G+A+P+PVL+E+IRTG P N ENAAAVLW Sbjct: 548 KIAIGEAEPIPVLVELIRTGSPRNRENAAAVLW 580 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 148 ETLAVLTIIASQREGR 101 ETLA+L I+AS EG+ Sbjct: 533 ETLAILAILASHPEGK 548 >ref|XP_011041060.1| PREDICTED: U-box domain-containing protein 14-like [Populus euphratica] Length = 628 Score = 57.8 bits (138), Expect = 4e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 104 KVATGQADPVPVLIEVIRTGYPHNGENAAAVLW 6 +VA GQADP+PVL+EVI TGYP N ENAAA+LW Sbjct: 542 RVAIGQADPIPVLMEVISTGYPRNRENAAAILW 574 >ref|XP_011024385.1| PREDICTED: U-box domain-containing protein 14-like [Populus euphratica] Length = 628 Score = 57.8 bits (138), Expect = 4e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 104 KVATGQADPVPVLIEVIRTGYPHNGENAAAVLW 6 +VA GQADP+PVL+EVI TGYP N ENAAA+LW Sbjct: 542 RVAIGQADPIPVLMEVISTGYPRNRENAAAILW 574 >ref|XP_012080958.1| PREDICTED: U-box domain-containing protein 14 [Jatropha curcas] gi|643719800|gb|KDP30475.1| hypothetical protein JCGZ_16154 [Jatropha curcas] Length = 630 Score = 56.6 bits (135), Expect = 1e-05 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 104 KVATGQADPVPVLIEVIRTGYPHNGENAAAVLW 6 KVA GQA+P+PVL+EVIRTG P N ENAAAVLW Sbjct: 542 KVAIGQAEPIPVLMEVIRTGSPRNRENAAAVLW 574 >ref|XP_012834964.1| PREDICTED: U-box domain-containing protein 14 [Erythranthe guttatus] gi|604335983|gb|EYU39871.1| hypothetical protein MIMGU_mgv1a002720mg [Erythranthe guttata] Length = 644 Score = 56.6 bits (135), Expect = 1e-05 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 104 KVATGQADPVPVLIEVIRTGYPHNGENAAAVLW 6 KVA GQA+P+P+L+EVIRTG P N ENAAA+LW Sbjct: 559 KVALGQAEPIPILVEVIRTGSPRNRENAAAILW 591