BLASTX nr result
ID: Aconitum23_contig00025143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025143 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobrom... 75 3e-11 ref|XP_012440182.1| PREDICTED: methyl-CpG-binding domain-contain... 73 1e-10 gb|KHG28622.1| Methyl-CpG-binding domain-containing 13 -like pro... 73 1e-10 ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-contain... 73 1e-10 ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964... 73 1e-10 ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-contain... 72 2e-10 ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-contain... 72 2e-10 ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-contain... 72 2e-10 ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-contain... 72 2e-10 ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415... 72 2e-10 ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454... 72 2e-10 emb|CBI34715.3| unnamed protein product [Vitis vinifera] 72 2e-10 ref|XP_012086963.1| PREDICTED: uncharacterized protein LOC105645... 71 3e-10 ref|XP_012086959.1| PREDICTED: uncharacterized protein LOC105645... 71 3e-10 ref|XP_012086958.1| PREDICTED: uncharacterized protein LOC105645... 71 3e-10 gb|KJB39638.1| hypothetical protein B456_007G022700 [Gossypium r... 70 5e-10 ref|XP_012488716.1| PREDICTED: methyl-CpG-binding domain-contain... 70 5e-10 ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX ho... 70 5e-10 ref|XP_007038659.1| Methyl-CPG-binding domain protein 13, putati... 70 5e-10 ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putati... 70 5e-10 >ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao] gi|508777412|gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao] Length = 1028 Score = 74.7 bits (182), Expect = 3e-11 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKR 175 W E+K R +G R DP YTDP SGY+FRSKKD+L Y++TGE+G+YA+ K+ Sbjct: 245 WIKEVKIKRHANGVRRDPYYTDPASGYVFRSKKDILRYLETGEIGRYAFLPKK 297 >ref|XP_012440182.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform X1 [Gossypium raimondii] gi|763785740|gb|KJB52811.1| hypothetical protein B456_008G278300 [Gossypium raimondii] Length = 600 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 WT E+K T+ + R DP YTDPVSGY+FRS KD L Y++TG+LGK A+K K Sbjct: 85 WTKEVKITKKGNKVRRDPFYTDPVSGYVFRSMKDALRYVETGKLGKLAFKPK 136 >gb|KHG28622.1| Methyl-CpG-binding domain-containing 13 -like protein [Gossypium arboreum] Length = 598 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 WT E+K T+ + R DP YTDPVSGY+FRS KD L Y++TG+LGK A+K K Sbjct: 85 WTKEVKITKKGNKVRRDPFYTDPVSGYVFRSMKDALRYVETGKLGKLAFKPK 136 >ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like isoform X2 [Pyrus x bretschneideri] Length = 1172 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/68 (50%), Positives = 47/68 (69%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKRGINSGKQ 154 W E+K T+ + R DP YTDP SGY+FRSKKDV+ Y++TGE+ KYA+K K N+ + Sbjct: 181 WIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVIRYLETGEMSKYAFKPKNMCNNDLK 240 Query: 153 ILVNPSLS 130 LVN ++ Sbjct: 241 -LVNDDIA 247 >ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus x bretschneideri] Length = 1224 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/68 (50%), Positives = 47/68 (69%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKRGINSGKQ 154 W E+K T+ + R DP YTDP SGY+FRSKKDV+ Y++TGE+ KYA+K K N+ + Sbjct: 181 WIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVIRYLETGEMSKYAFKPKNMCNNDLK 240 Query: 153 ILVNPSLS 130 LVN ++ Sbjct: 241 -LVNDDIA 247 >ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform X3 [Vitis vinifera] Length = 482 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 W E+K + +G R DP YTDPVSGY+FRS+KDV Y+KTGE+ ++A+K K Sbjct: 107 WIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFKPK 158 >ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform X2 [Vitis vinifera] Length = 496 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 W E+K + +G R DP YTDPVSGY+FRS+KDV Y+KTGE+ ++A+K K Sbjct: 121 WIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFKPK 172 >ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform X1 [Vitis vinifera] Length = 544 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 W E+K + +G R DP YTDPVSGY+FRS+KDV Y+KTGE+ ++A+K K Sbjct: 169 WIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFKPK 220 >ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform X4 [Vitis vinifera] Length = 462 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 W E+K + +G R DP YTDPVSGY+FRS+KDV Y+KTGE+ ++A+K K Sbjct: 87 WIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFKPK 138 >ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415104 [Malus domestica] Length = 746 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/68 (50%), Positives = 46/68 (67%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKRGINSGKQ 154 W E+K T+ + R DP YTDP SGY+FRSKKDV Y++TGE+ KYA+K K N+ + Sbjct: 181 WIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVFRYLETGEISKYAFKPKNMCNNDLK 240 Query: 153 ILVNPSLS 130 LVN ++ Sbjct: 241 -LVNDEIA 247 >ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica] Length = 1228 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/68 (50%), Positives = 46/68 (67%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKRGINSGKQ 154 W E+K T+ + R DP YTDP SGY+FRSKKDV Y++TGE+ KYA+K K N+ + Sbjct: 181 WIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVFRYLETGEISKYAFKPKNMCNNDLK 240 Query: 153 ILVNPSLS 130 LVN ++ Sbjct: 241 -LVNDEIA 247 >emb|CBI34715.3| unnamed protein product [Vitis vinifera] Length = 1076 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 W E+K + +G R DP YTDPVSGY+FRS+KDV Y+KTGE+ ++A+K K Sbjct: 121 WIKEIKIRMNENGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISRHAFKPK 172 >ref|XP_012086963.1| PREDICTED: uncharacterized protein LOC105645849 isoform X6 [Jatropha curcas] Length = 974 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/72 (41%), Positives = 52/72 (72%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKRGINSGKQ 154 W E+K T + +G R DP Y DP+ GY+FRSK+DV Y++TG++ K+A+ K+ ++G++ Sbjct: 88 WIKEIKITANANGIRKDPYYIDPIKGYVFRSKRDVERYLETGKISKHAFLPKKR-HTGER 146 Query: 153 ILVNPSLSLFII 118 ILV+ +L+ + + Sbjct: 147 ILVHVNLTCYFL 158 >ref|XP_012086959.1| PREDICTED: uncharacterized protein LOC105645849 isoform X2 [Jatropha curcas] Length = 1054 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/72 (41%), Positives = 52/72 (72%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKRGINSGKQ 154 W E+K T + +G R DP Y DP+ GY+FRSK+DV Y++TG++ K+A+ K+ ++G++ Sbjct: 168 WIKEIKITANANGIRKDPYYIDPIKGYVFRSKRDVERYLETGKISKHAFLPKKR-HTGER 226 Query: 153 ILVNPSLSLFII 118 ILV+ +L+ + + Sbjct: 227 ILVHVNLTCYFL 238 >ref|XP_012086958.1| PREDICTED: uncharacterized protein LOC105645849 isoform X1 [Jatropha curcas] Length = 1055 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/72 (41%), Positives = 52/72 (72%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKRGINSGKQ 154 W E+K T + +G R DP Y DP+ GY+FRSK+DV Y++TG++ K+A+ K+ ++G++ Sbjct: 169 WIKEIKITANANGIRKDPYYIDPIKGYVFRSKRDVERYLETGKISKHAFLPKKR-HTGER 227 Query: 153 ILVNPSLSLFII 118 ILV+ +L+ + + Sbjct: 228 ILVHVNLTCYFL 239 >gb|KJB39638.1| hypothetical protein B456_007G022700 [Gossypium raimondii] Length = 880 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAY 187 W E+K R+ +G R DP YTDPVSGY+FRSKK VLHY++TGE+ + A+ Sbjct: 138 WIKEIKIQRNANGVRKDPYYTDPVSGYVFRSKKAVLHYLETGEIARSAF 186 >ref|XP_012488716.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like isoform X1 [Gossypium raimondii] gi|763772514|gb|KJB39637.1| hypothetical protein B456_007G022700 [Gossypium raimondii] Length = 914 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAY 187 W E+K R+ +G R DP YTDPVSGY+FRSKK VLHY++TGE+ + A+ Sbjct: 172 WIKEIKIQRNANGVRKDPYYTDPVSGYVFRSKKAVLHYLETGEIARSAF 220 >ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 [Cucumis melo] Length = 628 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAKRGINSGKQ 154 W E+K DG R DP Y DP SGYIFRSKK+V Y++TGE+ ++A+K K G + ++ Sbjct: 168 WIKEIKIKEKADGIRKDPFYIDPKSGYIFRSKKEVFRYLETGEISRHAFKPKEGGDEEQE 227 Query: 153 IL 148 ++ Sbjct: 228 LI 229 >ref|XP_007038659.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma cacao] gi|508775904|gb|EOY23160.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma cacao] Length = 621 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 W E++ T+ R DP YTDPVSGY+FRS KD L Y++TGELGK A+K K Sbjct: 85 WIKEIRITKRAHRVRKDPFYTDPVSGYVFRSMKDALRYVETGELGKLAFKPK 136 >ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma cacao] gi|508775903|gb|EOY23159.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma cacao] Length = 625 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 333 WTMELKFTRSRDGTRNDPSYTDPVSGYIFRSKKDVLHYIKTGELGKYAYKAK 178 W E++ T+ R DP YTDPVSGY+FRS KD L Y++TGELGK A+K K Sbjct: 89 WIKEIRITKRAHRVRKDPFYTDPVSGYVFRSMKDALRYVETGELGKLAFKPK 140