BLASTX nr result
ID: Aconitum23_contig00024478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00024478 (389 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107110.1| hypothetical protein L484_019588 [Morus nota... 59 3e-13 gb|KHG12105.1| Ribosome production factor 1 [Gossypium arboreum] 56 2e-12 ref|XP_014521609.1| PREDICTED: ribosome production factor 1 [Vig... 59 5e-12 gb|KOM56975.1| hypothetical protein LR48_Vigan11g000700 [Vigna a... 59 5e-12 ref|XP_012480415.1| PREDICTED: ribosome production factor 1 [Gos... 54 6e-12 gb|KJB09557.1| hypothetical protein B456_001G149800 [Gossypium r... 54 6e-12 ref|XP_007051369.1| Ribosomal RNA processing Brix domain protein... 54 8e-12 ref|XP_007051371.1| Ribosomal RNA processing Brix domain protein... 54 8e-12 ref|XP_007153230.1| hypothetical protein PHAVU_003G017600g [Phas... 57 1e-11 ref|XP_002268541.2| PREDICTED: ribosome production factor 1-like... 59 1e-11 emb|CBI21662.3| unnamed protein product [Vitis vinifera] 59 1e-11 ref|XP_010652999.1| PREDICTED: ribosome production factor 1-like... 59 1e-11 emb|CDP18631.1| unnamed protein product [Coffea canephora] 56 1e-11 emb|CDP06320.1| unnamed protein product [Coffea canephora] 56 1e-11 emb|CAN66830.1| hypothetical protein VITISV_030888 [Vitis vinifera] 58 2e-11 ref|XP_004250972.1| PREDICTED: ribosome production factor 1 [Sol... 57 2e-11 ref|XP_010242770.1| PREDICTED: ribosome production factor 1-like... 58 2e-11 ref|NP_001275160.1| ribosome production factor 1-like [Solanum t... 57 2e-11 ref|XP_010542822.1| PREDICTED: ribosome production factor 1-like... 57 2e-11 ref|XP_010660166.1| PREDICTED: ribosome production factor 1-like... 59 2e-11 >ref|XP_010107110.1| hypothetical protein L484_019588 [Morus notabilis] gi|587926390|gb|EXC13631.1| hypothetical protein L484_019588 [Morus notabilis] Length = 352 Score = 58.5 bits (140), Expect(2) = 3e-13 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLSVIPNAHYYKRGTYDLKK+ + Sbjct: 139 PAFISELLSVIPNAHYYKRGTYDLKKIVEY 168 Score = 42.7 bits (99), Expect(2) = 3e-13 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYANNKEFTS++VVHT+R EP Sbjct: 166 VEYANNKEFTSIIVVHTNRREP 187 >gb|KHG12105.1| Ribosome production factor 1 [Gossypium arboreum] Length = 355 Score = 56.2 bits (134), Expect(2) = 2e-12 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFI+ELLSVIPN+HYYKRGTYDLKK+ + Sbjct: 141 PAFITELLSVIPNSHYYKRGTYDLKKIVEY 170 Score = 42.7 bits (99), Expect(2) = 2e-12 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYANNKEFTS++VVHT+R EP Sbjct: 168 VEYANNKEFTSIIVVHTNRREP 189 >ref|XP_014521609.1| PREDICTED: ribosome production factor 1 [Vigna radiata var. radiata] Length = 357 Score = 58.5 bits (140), Expect(2) = 5e-12 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLSVIPNAHYYKRGTYDLKK+ + Sbjct: 143 PAFISELLSVIPNAHYYKRGTYDLKKIVEY 172 Score = 38.9 bits (89), Expect(2) = 5e-12 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA NK+FTS++VVHT+R EP Sbjct: 170 VEYAKNKDFTSVIVVHTNRREP 191 >gb|KOM56975.1| hypothetical protein LR48_Vigan11g000700 [Vigna angularis] Length = 357 Score = 58.5 bits (140), Expect(2) = 5e-12 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLSVIPNAHYYKRGTYDLKK+ + Sbjct: 143 PAFISELLSVIPNAHYYKRGTYDLKKIVEY 172 Score = 38.9 bits (89), Expect(2) = 5e-12 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA NK+FTS++VVHT+R EP Sbjct: 170 VEYAKNKDFTSVIVVHTNRREP 191 >ref|XP_012480415.1| PREDICTED: ribosome production factor 1 [Gossypium raimondii] gi|763742057|gb|KJB09556.1| hypothetical protein B456_001G149800 [Gossypium raimondii] Length = 355 Score = 54.3 bits (129), Expect(2) = 6e-12 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFI+ELLSVIPN+HY+KRGTYDLKK+ + Sbjct: 141 PAFITELLSVIPNSHYHKRGTYDLKKIVEY 170 Score = 42.7 bits (99), Expect(2) = 6e-12 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYANNKEFTS++VVHT+R EP Sbjct: 168 VEYANNKEFTSIIVVHTNRREP 189 >gb|KJB09557.1| hypothetical protein B456_001G149800 [Gossypium raimondii] Length = 252 Score = 54.3 bits (129), Expect(2) = 6e-12 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFI+ELLSVIPN+HY+KRGTYDLKK+ + Sbjct: 38 PAFITELLSVIPNSHYHKRGTYDLKKIVEY 67 Score = 42.7 bits (99), Expect(2) = 6e-12 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYANNKEFTS++VVHT+R EP Sbjct: 65 VEYANNKEFTSIIVVHTNRREP 86 >ref|XP_007051369.1| Ribosomal RNA processing Brix domain protein isoform 1 [Theobroma cacao] gi|508703630|gb|EOX95526.1| Ribosomal RNA processing Brix domain protein isoform 1 [Theobroma cacao] Length = 354 Score = 53.9 bits (128), Expect(2) = 8e-12 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 P+FISELLSVIPNAHY KRGTYDLKK+ + Sbjct: 140 PSFISELLSVIPNAHYNKRGTYDLKKIVEY 169 Score = 42.7 bits (99), Expect(2) = 8e-12 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYANNKEFTS++VVHT+R EP Sbjct: 167 VEYANNKEFTSIIVVHTNRREP 188 >ref|XP_007051371.1| Ribosomal RNA processing Brix domain protein isoform 3, partial [Theobroma cacao] gi|508703632|gb|EOX95528.1| Ribosomal RNA processing Brix domain protein isoform 3, partial [Theobroma cacao] Length = 274 Score = 53.9 bits (128), Expect(2) = 8e-12 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 P+FISELLSVIPNAHY KRGTYDLKK+ + Sbjct: 60 PSFISELLSVIPNAHYNKRGTYDLKKIVEY 89 Score = 42.7 bits (99), Expect(2) = 8e-12 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYANNKEFTS++VVHT+R EP Sbjct: 87 VEYANNKEFTSIIVVHTNRREP 108 >ref|XP_007153230.1| hypothetical protein PHAVU_003G017600g [Phaseolus vulgaris] gi|561026584|gb|ESW25224.1| hypothetical protein PHAVU_003G017600g [Phaseolus vulgaris] Length = 357 Score = 57.0 bits (136), Expect(2) = 1e-11 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLSVIPNAHY+KRGTYDLKK+ + Sbjct: 143 PAFISELLSVIPNAHYFKRGTYDLKKIVEY 172 Score = 39.3 bits (90), Expect(2) = 1e-11 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA NK+FTS++VVHT+R EP Sbjct: 170 VEYAKNKDFTSIIVVHTNRREP 191 >ref|XP_002268541.2| PREDICTED: ribosome production factor 1-like isoform X1 [Vitis vinifera] gi|731397758|ref|XP_010652998.1| PREDICTED: ribosome production factor 1-like isoform X1 [Vitis vinifera] Length = 346 Score = 58.5 bits (140), Expect(2) = 1e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLSVIPNAHYYKRGTYDLKK+ + Sbjct: 132 PAFISELLSVIPNAHYYKRGTYDLKKIVEY 161 Score = 37.7 bits (86), Expect(2) = 1e-11 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA K+FTSL+VVHT+R EP Sbjct: 159 VEYAKKKDFTSLIVVHTNRREP 180 >emb|CBI21662.3| unnamed protein product [Vitis vinifera] Length = 319 Score = 58.5 bits (140), Expect(2) = 1e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLSVIPNAHYYKRGTYDLKK+ + Sbjct: 105 PAFISELLSVIPNAHYYKRGTYDLKKIVEY 134 Score = 37.7 bits (86), Expect(2) = 1e-11 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA K+FTSL+VVHT+R EP Sbjct: 132 VEYAKKKDFTSLIVVHTNRREP 153 >ref|XP_010652999.1| PREDICTED: ribosome production factor 1-like isoform X2 [Vitis vinifera] Length = 305 Score = 58.5 bits (140), Expect(2) = 1e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLSVIPNAHYYKRGTYDLKK+ + Sbjct: 91 PAFISELLSVIPNAHYYKRGTYDLKKIVEY 120 Score = 37.7 bits (86), Expect(2) = 1e-11 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA K+FTSL+VVHT+R EP Sbjct: 118 VEYAKKKDFTSLIVVHTNRREP 139 >emb|CDP18631.1| unnamed protein product [Coffea canephora] Length = 509 Score = 55.8 bits (133), Expect(2) = 1e-11 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFIS+LLSVIPNAHY+KRGTYDLKK+ + Sbjct: 296 PAFISDLLSVIPNAHYFKRGTYDLKKIVEY 325 Score = 40.0 bits (92), Expect(2) = 1e-11 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA NKEFTS++VVHT+R EP Sbjct: 323 VEYAKNKEFTSVIVVHTNRREP 344 >emb|CDP06320.1| unnamed protein product [Coffea canephora] Length = 359 Score = 55.8 bits (133), Expect(2) = 1e-11 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFIS+LLSVIPNAHY+KRGTYDLKK+ + Sbjct: 146 PAFISDLLSVIPNAHYFKRGTYDLKKIVEY 175 Score = 40.0 bits (92), Expect(2) = 1e-11 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA NKEFTS++VVHT+R EP Sbjct: 173 VEYAENKEFTSVIVVHTNRREP 194 >emb|CAN66830.1| hypothetical protein VITISV_030888 [Vitis vinifera] Length = 383 Score = 57.8 bits (138), Expect(2) = 2e-11 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKL 82 PAFISELLSVIPNAHYYKRGTYDLKK+ Sbjct: 153 PAFISELLSVIPNAHYYKRGTYDLKKV 179 Score = 37.7 bits (86), Expect(2) = 2e-11 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA K+FTSL+VVHT+R EP Sbjct: 182 VEYAKKKDFTSLIVVHTNRREP 203 >ref|XP_004250972.1| PREDICTED: ribosome production factor 1 [Solanum lycopersicum] Length = 355 Score = 56.6 bits (135), Expect(2) = 2e-11 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFIS+L+SVIPNAHYYKRGTYDLKK+ + Sbjct: 144 PAFISDLISVIPNAHYYKRGTYDLKKIVQY 173 Score = 38.9 bits (89), Expect(2) = 2e-11 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 V+YAN KEFTS++VVHT+R EP Sbjct: 171 VQYANEKEFTSVIVVHTNRREP 192 >ref|XP_010242770.1| PREDICTED: ribosome production factor 1-like [Nelumbo nucifera] Length = 352 Score = 58.2 bits (139), Expect(2) = 2e-11 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLS+IPNAHYYKRGTYDLKK+ + Sbjct: 138 PAFISELLSIIPNAHYYKRGTYDLKKIVEY 167 Score = 37.4 bits (85), Expect(2) = 2e-11 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA +K+FTS++VVHT+R EP Sbjct: 165 VEYAKSKDFTSIIVVHTNRREP 186 >ref|NP_001275160.1| ribosome production factor 1-like [Solanum tuberosum] gi|82621156|gb|ABB86266.1| putative RNA processing factor 1-like [Solanum tuberosum] Length = 335 Score = 56.6 bits (135), Expect(2) = 2e-11 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFIS+L+SVIPNAHYYKRGTYDLKK+ + Sbjct: 124 PAFISDLISVIPNAHYYKRGTYDLKKIVQY 153 Score = 38.9 bits (89), Expect(2) = 2e-11 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 V+YAN KEFTS++VVHT+R EP Sbjct: 151 VQYANEKEFTSVIVVHTNRREP 172 >ref|XP_010542822.1| PREDICTED: ribosome production factor 1-like [Tarenaya hassleriana] Length = 359 Score = 57.0 bits (136), Expect(2) = 2e-11 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAF+SELLSVIPN+HYYKRGTYDLKK+ + Sbjct: 144 PAFVSELLSVIPNSHYYKRGTYDLKKIVEY 173 Score = 38.1 bits (87), Expect(2) = 2e-11 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA K+FTSLVVVHT+R EP Sbjct: 171 VEYAKKKDFTSLVVVHTNRREP 192 >ref|XP_010660166.1| PREDICTED: ribosome production factor 1-like isoform X1 [Vitis vinifera] gi|731417097|ref|XP_010660167.1| PREDICTED: ribosome production factor 1-like isoform X1 [Vitis vinifera] gi|731417099|ref|XP_010660168.1| PREDICTED: ribosome production factor 1-like isoform X1 [Vitis vinifera] gi|302143564|emb|CBI22317.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 58.5 bits (140), Expect(2) = 2e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 PAFISELLSVIPNAHYYKRGTYDLKKLSHF 91 PAFISELLSVIPNAHYYKRGTYDLKK+ + Sbjct: 132 PAFISELLSVIPNAHYYKRGTYDLKKIVEY 161 Score = 36.6 bits (83), Expect(2) = 2e-11 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 115 VEYANNKEFTSLVVVHTSRGEP 180 VEYA K+FTSL+VVHT+R EP Sbjct: 159 VEYAKIKDFTSLIVVHTNRREP 180