BLASTX nr result
ID: Aconitum23_contig00024363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00024363 (337 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379886.1| hypothetical protein POPTR_0008s16530g [Popu... 65 3e-08 ref|XP_007035072.1| 2-oxoglutarate and Fe(II)-dependent oxygenas... 63 8e-08 ref|XP_010262287.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 62 1e-07 ref|XP_010026849.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 62 1e-07 gb|KCW60387.1| hypothetical protein EUGRSUZ_H03103 [Eucalyptus g... 62 1e-07 ref|XP_006489571.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 62 1e-07 ref|XP_010274816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 62 2e-07 gb|KRH46704.1| hypothetical protein GLYMA_08G351900 [Glycine max] 62 2e-07 gb|KOM37923.1| hypothetical protein LR48_Vigan03g130500 [Vigna a... 62 2e-07 gb|KJB34550.1| hypothetical protein B456_006G071900 [Gossypium r... 62 2e-07 gb|KJB34548.1| hypothetical protein B456_006G071900 [Gossypium r... 62 2e-07 gb|KJB34546.1| hypothetical protein B456_006G071900 [Gossypium r... 62 2e-07 gb|KJB34545.1| hypothetical protein B456_006G071900 [Gossypium r... 62 2e-07 gb|KJB34544.1| hypothetical protein B456_006G071900 [Gossypium r... 62 2e-07 gb|KHN11000.1| 1-aminocyclopropane-1-carboxylate oxidase like 12... 62 2e-07 gb|KHG16548.1| hypothetical protein F383_20832 [Gossypium arboreum] 62 2e-07 ref|XP_002529300.1| Desacetoxyvindoline 4-hydroxylase, putative ... 62 2e-07 ref|XP_006586237.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 62 2e-07 ref|XP_007035063.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 62 2e-07 ref|XP_011029845.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo... 61 3e-07 >ref|XP_006379886.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa] gi|550333225|gb|ERP57683.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa] Length = 372 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PPVYR T+IKDY SY YSK LD L HFKL Sbjct: 329 YGPIKELLSEENPPVYRQTTIKDYVSYTYSKG--LDGNPRLEHFKL 372 >ref|XP_007035072.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein isoform 1 [Theobroma cacao] gi|508714101|gb|EOY05998.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein isoform 1 [Theobroma cacao] Length = 369 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PPVYR+T+++D+ +Y+ SK LDE + L+HFKL Sbjct: 324 YGPIKELLSEENPPVYRETTVQDFINYY--DSKGLDENSALTHFKL 367 >ref|XP_010262287.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog [Nelumbo nucifera] Length = 372 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PP+YR+ +I +++SYFYSK LD +L HFKL Sbjct: 329 YGPIKELLSEENPPIYREITIPEFSSYFYSKG--LDGSPMLDHFKL 372 >ref|XP_010026849.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Eucalyptus grandis] Length = 447 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PP+YR+TS+KDY Y YSK LD + H KL Sbjct: 404 YGPIKELLSEENPPLYRETSVKDYVKYIYSKG--LDGVPAIDHLKL 447 >gb|KCW60387.1| hypothetical protein EUGRSUZ_H03103 [Eucalyptus grandis] Length = 344 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PP+YR+TS+KDY Y YSK LD + H KL Sbjct: 301 YGPIKELLSEENPPLYRETSVKDYVKYIYSKG--LDGVPAIDHLKL 344 >ref|XP_006489571.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like isoform X1 [Citrus sinensis] gi|568872842|ref|XP_006489572.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like isoform X2 [Citrus sinensis] gi|568872844|ref|XP_006489573.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like isoform X3 [Citrus sinensis] gi|568872846|ref|XP_006489574.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like isoform X4 [Citrus sinensis] Length = 367 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PPVYR+TS++D+ +Y+ +SK LD + L+HFKL Sbjct: 322 YGPIKELLSEENPPVYRETSVQDFIAYY--ESKGLDGNSALTHFKL 365 >ref|XP_010274816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Nelumbo nucifera] Length = 411 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PPVYR+T+++DY Y+ SK L T LSHFKL Sbjct: 368 YGPIKELLSEENPPVYRETTVQDYVEYY--NSKGLGGGTALSHFKL 411 >gb|KRH46704.1| hypothetical protein GLYMA_08G351900 [Glycine max] Length = 670 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKEL+SEE+PP+YRDT+IKD+ +Y+Y+K+ LD + L+ F+L Sbjct: 627 YGPIKELISEENPPIYRDTTIKDFVAYYYAKA--LDGKSSLNRFRL 670 >gb|KOM37923.1| hypothetical protein LR48_Vigan03g130500 [Vigna angularis] Length = 373 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PPVYRDTSIKDY +++Y+K LD + L F+L Sbjct: 327 YGPIKELLSEENPPVYRDTSIKDYLAHYYAKG--LDGNSSLDPFRL 370 >gb|KJB34550.1| hypothetical protein B456_006G071900 [Gossypium raimondii] Length = 350 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLS+E+PP+YR+T+++D+ SY+ SK LDE + L+HFKL Sbjct: 305 YGPIKELLSKENPPLYRETTVEDFISYY--DSKGLDEKSALAHFKL 348 >gb|KJB34548.1| hypothetical protein B456_006G071900 [Gossypium raimondii] Length = 176 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLS+E+PP+YR+T+++D+ SY+ SK LDE + L+HFKL Sbjct: 131 YGPIKELLSKENPPLYRETTVEDFISYY--DSKGLDEKSALAHFKL 174 >gb|KJB34546.1| hypothetical protein B456_006G071900 [Gossypium raimondii] Length = 189 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLS+E+PP+YR+T+++D+ SY+ SK LDE + L+HFKL Sbjct: 144 YGPIKELLSKENPPLYRETTVEDFISYY--DSKGLDEKSALAHFKL 187 >gb|KJB34545.1| hypothetical protein B456_006G071900 [Gossypium raimondii] Length = 259 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLS+E+PP+YR+T+++D+ SY+ SK LDE + L+HFKL Sbjct: 214 YGPIKELLSKENPPLYRETTVEDFISYY--DSKGLDEKSALAHFKL 257 >gb|KJB34544.1| hypothetical protein B456_006G071900 [Gossypium raimondii] gi|763767334|gb|KJB34549.1| hypothetical protein B456_006G071900 [Gossypium raimondii] Length = 246 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLS+E+PP+YR+T+++D+ SY+ SK LDE + L+HFKL Sbjct: 201 YGPIKELLSKENPPLYRETTVEDFISYY--DSKGLDEKSALAHFKL 244 >gb|KHN11000.1| 1-aminocyclopropane-1-carboxylate oxidase like 12 [Glycine soja] Length = 333 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKEL+SEE+PP+YRDT+IKD+ +Y+Y+K+ LD + L+ F+L Sbjct: 290 YGPIKELISEENPPIYRDTTIKDFVAYYYAKA--LDGKSSLNRFRL 333 >gb|KHG16548.1| hypothetical protein F383_20832 [Gossypium arboreum] Length = 370 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLS+E+PP+YR+T+++D+ SY+ SK LDE + L+HFKL Sbjct: 325 YGPIKELLSKENPPLYRETTVEDFISYY--DSKGLDEKSALAHFKL 368 >ref|XP_002529300.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] gi|223531224|gb|EEF33069.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] Length = 364 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+PPVY +T+IK+Y +Y+YSK L+ + L HFKL Sbjct: 321 YGPIKELLSEETPPVYLETTIKEYLTYYYSKG--LNGISALEHFKL 364 >ref|XP_006586237.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 12-like [Glycine max] Length = 379 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKEL+SEE+PP+YRDT+IKD+ +Y+Y+K+ LD + L+ F+L Sbjct: 336 YGPIKELISEENPPIYRDTTIKDFVAYYYAKA--LDGKSSLNRFRL 379 >ref|XP_007035063.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein, putative [Theobroma cacao] gi|508714092|gb|EOY05989.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein, putative [Theobroma cacao] Length = 352 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSE++PP+YRD + +D+ +Y YSK +DE + L+HFKL Sbjct: 309 YGPIKELLSEDNPPIYRDITARDFLTYIYSKG--IDEVSSLAHFKL 352 >ref|XP_011029845.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate oxidase homolog 1 [Populus euphratica] Length = 372 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -3 Query: 335 YGPIKELLSEESPPVYRDTSIKDYTSYFYSKSKELDEYTILSHFKL 198 YGPIKELLSEE+ P+YR T+IKDY SY YSK LD L HFKL Sbjct: 329 YGPIKELLSEENQPIYRQTTIKDYVSYTYSKG--LDGNPRLEHFKL 372