BLASTX nr result
ID: Aconitum23_contig00024125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00024125 (416 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451615.1| hypothetical protein CICLE_v10008944mg [Citr... 79 2e-12 gb|KJB30186.1| hypothetical protein B456_005G133000 [Gossypium r... 78 3e-12 ref|XP_012478536.1| PREDICTED: prostaglandin E synthase 2-like [... 78 3e-12 ref|XP_004512741.1| PREDICTED: prostaglandin E synthase 2-like [... 78 3e-12 ref|XP_008240147.1| PREDICTED: prostaglandin E synthase 2-like [... 77 4e-12 ref|XP_007209338.1| hypothetical protein PRUPE_ppa008397mg [Prun... 77 4e-12 ref|XP_007209337.1| hypothetical protein PRUPE_ppa008397mg [Prun... 77 4e-12 ref|XP_007209336.1| hypothetical protein PRUPE_ppa008397mg [Prun... 77 4e-12 emb|CBI15579.3| unnamed protein product [Vitis vinifera] 77 5e-12 ref|XP_007036818.1| Glutathione S-transferase family protein iso... 77 5e-12 ref|XP_002282513.1| PREDICTED: prostaglandin E synthase 2 [Vitis... 77 5e-12 emb|CAN72718.1| hypothetical protein VITISV_038395 [Vitis vinifera] 77 5e-12 gb|KHG12991.1| Prostaglandin E synthase 2 [Gossypium arboreum] 76 1e-11 ref|XP_010046210.1| PREDICTED: prostaglandin E synthase 2-like [... 75 1e-11 ref|XP_010034343.1| PREDICTED: prostaglandin E synthase 2-like [... 75 1e-11 ref|XP_010274064.1| PREDICTED: prostaglandin E synthase 2-like i... 75 2e-11 ref|XP_010273989.1| PREDICTED: prostaglandin E synthase 2-like i... 75 2e-11 ref|XP_010273922.1| PREDICTED: prostaglandin E synthase 2-like i... 75 2e-11 ref|XP_004299526.1| PREDICTED: prostaglandin E synthase 2-like [... 75 2e-11 ref|XP_008364927.1| PREDICTED: prostaglandin E synthase 2-like [... 75 3e-11 >ref|XP_006451615.1| hypothetical protein CICLE_v10008944mg [Citrus clementina] gi|568875379|ref|XP_006490776.1| PREDICTED: prostaglandin E synthase 2-like [Citrus sinensis] gi|557554841|gb|ESR64855.1| hypothetical protein CICLE_v10008944mg [Citrus clementina] gi|641844944|gb|KDO63835.1| hypothetical protein CISIN_1g020964mg [Citrus sinensis] Length = 319 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSG+DMVE+TRIGEWY RMERVVGESSRIKA Sbjct: 279 GVLRPIRYLRSGRDMVEHTRIGEWYTRMERVVGESSRIKA 318 >gb|KJB30186.1| hypothetical protein B456_005G133000 [Gossypium raimondii] Length = 329 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSG+DMVE+TRIGEWY+RME+VVGESSRIKA Sbjct: 290 GVLRPIRYLRSGRDMVEHTRIGEWYSRMEKVVGESSRIKA 329 >ref|XP_012478536.1| PREDICTED: prostaglandin E synthase 2-like [Gossypium raimondii] gi|763762930|gb|KJB30184.1| hypothetical protein B456_005G133000 [Gossypium raimondii] Length = 328 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSG+DMVE+TRIGEWY+RME+VVGESSRIKA Sbjct: 289 GVLRPIRYLRSGRDMVEHTRIGEWYSRMEKVVGESSRIKA 328 >ref|XP_004512741.1| PREDICTED: prostaglandin E synthase 2-like [Cicer arietinum] Length = 323 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSGKDMVE+TRIGEWY RMERVVGE SRIKA Sbjct: 284 GVLRPIRYLRSGKDMVEHTRIGEWYTRMERVVGEPSRIKA 323 >ref|XP_008240147.1| PREDICTED: prostaglandin E synthase 2-like [Prunus mume] Length = 333 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSGKDMVE+TRIGEWY+RMER VGES+RIKA Sbjct: 294 GVLRPIRYLRSGKDMVEHTRIGEWYSRMERAVGESARIKA 333 >ref|XP_007209338.1| hypothetical protein PRUPE_ppa008397mg [Prunus persica] gi|462405073|gb|EMJ10537.1| hypothetical protein PRUPE_ppa008397mg [Prunus persica] Length = 333 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSGKDMVE+TRIGEWY+RMER VGES+RIKA Sbjct: 294 GVLRPIRYLRSGKDMVEHTRIGEWYSRMERAVGESARIKA 333 >ref|XP_007209337.1| hypothetical protein PRUPE_ppa008397mg [Prunus persica] gi|462405072|gb|EMJ10536.1| hypothetical protein PRUPE_ppa008397mg [Prunus persica] Length = 288 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSGKDMVE+TRIGEWY+RMER VGES+RIKA Sbjct: 249 GVLRPIRYLRSGKDMVEHTRIGEWYSRMERAVGESARIKA 288 >ref|XP_007209336.1| hypothetical protein PRUPE_ppa008397mg [Prunus persica] gi|462405071|gb|EMJ10535.1| hypothetical protein PRUPE_ppa008397mg [Prunus persica] Length = 227 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSGKDMVE+TRIGEWY+RMER VGES+RIKA Sbjct: 188 GVLRPIRYLRSGKDMVEHTRIGEWYSRMERAVGESARIKA 227 >emb|CBI15579.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSG+DMVENTRIGEWY RME VGESSRIKA Sbjct: 296 GVLRPIRYLRSGRDMVENTRIGEWYTRMENAVGESSRIKA 335 >ref|XP_007036818.1| Glutathione S-transferase family protein isoform 2 [Theobroma cacao] gi|508774063|gb|EOY21319.1| Glutathione S-transferase family protein isoform 2 [Theobroma cacao] Length = 330 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSG+DMVE+TRIGEWY+RME VVGESSRIKA Sbjct: 291 GVLRPIRYLRSGRDMVEHTRIGEWYSRMEEVVGESSRIKA 330 >ref|XP_002282513.1| PREDICTED: prostaglandin E synthase 2 [Vitis vinifera] Length = 349 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSG+DMVENTRIGEWY RME VGESSRIKA Sbjct: 310 GVLRPIRYLRSGRDMVENTRIGEWYTRMENAVGESSRIKA 349 >emb|CAN72718.1| hypothetical protein VITISV_038395 [Vitis vinifera] Length = 227 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSG+DMVENTRIGEWY RME VGESSRIKA Sbjct: 188 GVLRPIRYLRSGRDMVENTRIGEWYTRMENAVGESSRIKA 227 >gb|KHG12991.1| Prostaglandin E synthase 2 [Gossypium arboreum] Length = 328 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSG+DMVE+TRIGEWY+RME+VVGE SRIKA Sbjct: 289 GVLRPIRYLRSGRDMVEHTRIGEWYSRMEKVVGEPSRIKA 328 >ref|XP_010046210.1| PREDICTED: prostaglandin E synthase 2-like [Eucalyptus grandis] Length = 123 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSGKDMVE+TRIGEWY+RME VGESSRIKA Sbjct: 84 GVLRPIRYLRSGKDMVEHTRIGEWYSRMESSVGESSRIKA 123 >ref|XP_010034343.1| PREDICTED: prostaglandin E synthase 2-like [Eucalyptus grandis] gi|629119629|gb|KCW84119.1| hypothetical protein EUGRSUZ_B01000 [Eucalyptus grandis] Length = 336 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYLRSGKDMVE+TRIGEWY+RME VGESSRIKA Sbjct: 297 GVLRPIRYLRSGKDMVEHTRIGEWYSRMESSVGESSRIKA 336 >ref|XP_010274064.1| PREDICTED: prostaglandin E synthase 2-like isoform X3 [Nelumbo nucifera] Length = 279 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYL+SG+DMVENTRIG+WYARME VGESSRIK+ Sbjct: 237 GVLRPIRYLKSGRDMVENTRIGDWYARMEEAVGESSRIKS 276 >ref|XP_010273989.1| PREDICTED: prostaglandin E synthase 2-like isoform X2 [Nelumbo nucifera] Length = 314 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYL+SG+DMVENTRIG+WYARME VGESSRIK+ Sbjct: 272 GVLRPIRYLKSGRDMVENTRIGDWYARMEEAVGESSRIKS 311 >ref|XP_010273922.1| PREDICTED: prostaglandin E synthase 2-like isoform X1 [Nelumbo nucifera] Length = 339 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIRYL+SG+DMVENTRIG+WYARME VGESSRIK+ Sbjct: 297 GVLRPIRYLKSGRDMVENTRIGDWYARMEEAVGESSRIKS 336 >ref|XP_004299526.1| PREDICTED: prostaglandin E synthase 2-like [Fragaria vesca subsp. vesca] Length = 335 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIK 300 GVLRPIRYLRSGKDMVE+TRIGEWY+RMER VGE SRIK Sbjct: 296 GVLRPIRYLRSGKDMVEHTRIGEWYSRMERAVGEPSRIK 334 >ref|XP_008364927.1| PREDICTED: prostaglandin E synthase 2-like [Malus domestica] Length = 323 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 416 GVLRPIRYLRSGKDMVENTRIGEWYARMERVVGESSRIKA 297 GVLRPIR+L+SGKDMVENTRIGEWYARME VGES+R+KA Sbjct: 284 GVLRPIRHLKSGKDMVENTRIGEWYARMESAVGESARVKA 323