BLASTX nr result
ID: Aconitum23_contig00023348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00023348 (592 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010938736.1| PREDICTED: putative disease resistance prote... 40 6e-06 >ref|XP_010938736.1| PREDICTED: putative disease resistance protein RGA3 [Elaeis guineensis] Length = 1138 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = +2 Query: 56 FNNLDCVRAVDLSHITISDLPETI*KIKH 142 F NL C+RA+DLSH I +LP++I ++KH Sbjct: 604 FQNLTCLRAMDLSHSAIEELPDSIGELKH 632 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 18/49 (36%), Positives = 32/49 (65%) Frame = +1 Query: 142 LKSISTSSDPDHICLLKNM*RSLNLREYQNLTNLPNGISRLTNLKHLVI 288 L++ S P+ +C+L N+ + L+L+ +L LP GI LT+L+HL++ Sbjct: 638 LQNTSIRVLPESVCVLYNL-QVLDLKHCYDLLELPRGIGNLTSLRHLIL 685