BLASTX nr result
ID: Aconitum23_contig00023341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00023341 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010271590.1| PREDICTED: putative RNA polymerase II subuni... 66 9e-09 >ref|XP_010271590.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog [Nelumbo nucifera] gi|720049898|ref|XP_010271591.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog [Nelumbo nucifera] Length = 650 Score = 66.2 bits (160), Expect = 9e-09 Identities = 35/70 (50%), Positives = 47/70 (67%) Frame = -1 Query: 212 GIPEMVYDSGENASNRGGEESKKEVLVNKNTESNEMRLNSSLKVPGAKKLARSVTWADER 33 GIP SG+N S+ G+E+K ++ V K +S E L SS+K PGAKKL R+VTWADER Sbjct: 289 GIPGKTL-SGQNVSDTSGQETKIKLDVGKTIQSGETALKSSIKPPGAKKLTRNVTWADER 347 Query: 32 KTGAPLNSSL 3 ++G N +L Sbjct: 348 ESGKVGNDNL 357