BLASTX nr result
ID: Aconitum23_contig00022856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00022856 (530 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB10380.1| reverse transcriptase like protein [Arabidopsis ... 57 4e-06 gb|AAC67200.1| putative retroelement pol polyprotein [Arabidopsi... 57 4e-06 ref|XP_010430968.1| PREDICTED: uncharacterized protein LOC104715... 56 9e-06 >emb|CAB10380.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268350|emb|CAB78643.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 1942 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -2 Query: 109 VHINLWGPSPVMSVQGYEYYASFVYAYNRYCW 14 +H +LWGPSPVMSVQG+ YY F+ Y+RYCW Sbjct: 446 IHCDLWGPSPVMSVQGFRYYVIFIDNYSRYCW 477 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -2 Query: 109 VHINLWGPSPVMSVQGYEYYASFVYAYNRYCW 14 +H +LWGPSPVMSVQG+ YY F+ Y+RYCW Sbjct: 1346 IHCDLWGPSPVMSVQGFRYYVIFIDNYSRYCW 1377 >gb|AAC67200.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1402 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -2 Query: 124 RPLQLVHINLWGPSPVMSVQGYEYYASFVYAYNRYCW 14 RPL+ VH +LWGPSP+ SVQG+ YYA F+ Y+R+ W Sbjct: 520 RPLERVHCDLWGPSPITSVQGFRYYAVFIDHYSRFSW 556 >ref|XP_010430968.1| PREDICTED: uncharacterized protein LOC104715244 [Camelina sativa] Length = 618 Score = 56.2 bits (134), Expect = 9e-06 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = -2 Query: 121 PLQLVHINLWGPSPVMSVQGYEYYASFVYAYNRYCW 14 P+ +H +LWGPSPV+SVQG++YY F+ A++RY W Sbjct: 538 PIDRIHCDLWGPSPVVSVQGFKYYVVFINAFSRYSW 573