BLASTX nr result
ID: Aconitum23_contig00022454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00022454 (754 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009049681.1| hypothetical protein (mitochondrion) [Capsic... 125 3e-26 ref|XP_002535452.1| conserved hypothetical protein [Ricinus comm... 97 9e-18 ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494... 82 3e-13 ref|XP_010098133.1| hypothetical protein L484_026267 [Morus nota... 70 3e-10 gb|KRH04772.1| hypothetical protein GLYMA_17G185800 [Glycine max] 65 5e-08 ref|XP_007211045.1| hypothetical protein PRUPE_ppa019081mg, part... 58 8e-06 >ref|YP_009049681.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751825|gb|AIG89912.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751953|gb|AIG90039.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 107 Score = 125 bits (314), Expect = 3e-26 Identities = 61/73 (83%), Positives = 64/73 (87%) Frame = -3 Query: 221 IFSGLS*LYRRIIGTPTPGRVSEPCNRRPFRAVRGALESAAGARLRLDPYPIFGPIPSLY 42 + SG + RRIIGT TPGRVSEPCNRRPFRAVRGALESAAGAR RLDP+PIFGPIP Y Sbjct: 29 LLSGSGQITRRIIGTHTPGRVSEPCNRRPFRAVRGALESAAGARQRLDPHPIFGPIPPSY 88 Query: 41 YQKMRFLPNPSLL 3 YQKMRFLPNPSLL Sbjct: 89 YQKMRFLPNPSLL 101 >ref|XP_002535452.1| conserved hypothetical protein [Ricinus communis] gi|223523063|gb|EEF26931.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 97.4 bits (241), Expect = 9e-18 Identities = 49/52 (94%), Positives = 49/52 (94%) Frame = +2 Query: 2 AANSDSARISFFGSTKRELAQKLDRGQDAVGRRRLTQVPPEPREMVAYYTAH 157 AANSDSARISFFGSTK ELAQK DRGQDAVGRRRLTQVP EPREMVAYYTAH Sbjct: 4 AANSDSARISFFGSTKGELAQKWDRGQDAVGRRRLTQVPLEPREMVAYYTAH 55 >ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494761 [Cicer arietinum] Length = 420 Score = 82.4 bits (202), Expect = 3e-13 Identities = 44/62 (70%), Positives = 45/62 (72%) Frame = -3 Query: 194 RRIIGTPTPGRVSEPCNRRPFRAVRGALESAAGARLRLDPYPIFGPIPSLYYQKMRFLPN 15 RRIIGTPTP A GALESAAG+RLRLDPYPIFGPIP YYQKMRFLPN Sbjct: 48 RRIIGTPTPQAELVSGVIGDHFARFGALESAAGSRLRLDPYPIFGPIPPSYYQKMRFLPN 107 Query: 14 PS 9 PS Sbjct: 108 PS 109 >ref|XP_010098133.1| hypothetical protein L484_026267 [Morus notabilis] gi|587885713|gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 69.7 bits (169), Expect(2) = 3e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 176 PTPGRVSEPCNRRPFRAVRGALESAAGARLRLDP 75 PTPGRVSEPCNRRPFRAVRGALESAAGARLRL P Sbjct: 124 PTPGRVSEPCNRRPFRAVRGALESAAGARLRLVP 157 Score = 23.1 bits (48), Expect(2) = 3e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 195 PTNNRYPHP 169 PTNNRYP P Sbjct: 118 PTNNRYPTP 126 >gb|KRH04772.1| hypothetical protein GLYMA_17G185800 [Glycine max] Length = 309 Score = 65.1 bits (157), Expect = 5e-08 Identities = 32/44 (72%), Positives = 32/44 (72%) Frame = -1 Query: 166 AELVSRVIGDHFARFGGHLSQPPAPDCVLTPIQFLGQFPLCTTK 35 AELVSRVIGDHFARFGGHLSQP APDCVLT F P K Sbjct: 53 AELVSRVIGDHFARFGGHLSQPLAPDCVLTLSNFWANSPFVLPK 96 >ref|XP_007211045.1| hypothetical protein PRUPE_ppa019081mg, partial [Prunus persica] gi|462406780|gb|EMJ12244.1| hypothetical protein PRUPE_ppa019081mg, partial [Prunus persica] Length = 84 Score = 57.8 bits (138), Expect = 8e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 157 VSRVIGDHFARFGGHLSQPPAPDCVLTPIQF 65 VSRVIG HFARFGGHLSQPPAPDC+L +F Sbjct: 22 VSRVIGYHFARFGGHLSQPPAPDCILAESEF 52