BLASTX nr result
ID: Aconitum23_contig00021155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00021155 (628 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266362.1| PREDICTED: DNA ligase 1-like [Vitis vinifera] 58 4e-06 >ref|XP_002266362.1| PREDICTED: DNA ligase 1-like [Vitis vinifera] Length = 382 Score = 58.2 bits (139), Expect = 4e-06 Identities = 27/50 (54%), Positives = 40/50 (80%) Frame = -2 Query: 393 MEDKSESMVNKQEMLEKKEIHLKVESKVKDHVAEKVDKTEMEVEVKTKSV 244 MED SES+ +QE +EK+E+H++V++KVK+ EK +K EME+E+K KSV Sbjct: 1 MEDNSESIAKEQERVEKEEVHVQVKNKVKEPNKEKEEKEEMELELKKKSV 50