BLASTX nr result
ID: Aconitum23_contig00021073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00021073 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulga... 57 4e-06 >emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1369 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/90 (32%), Positives = 49/90 (54%) Frame = +3 Query: 6 DRGYNFLIVESDCQIAINKILQKEIDPGPIGLLIYDLKEQFATHWETVDFRFIPRTCNNV 185 + G+ L+VE DC+ ++ K D P G ++ D+ A+ V F + R CN V Sbjct: 1276 EAGFRNLVVEMDCKKLFLQLRGKASDVTPFGRVVDDIL-YLASKCSNVVFEHVKRHCNKV 1334 Query: 186 AHQMASIGKNSLEDKVWYCNFPYEIRRSIL 275 AH +A + KN++E +VW +P E+ ++L Sbjct: 1335 AHLLAQMCKNAMEKRVWLEEYPSEVSSAVL 1364