BLASTX nr result
ID: Aconitum23_contig00019846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00019846 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010253760.1| PREDICTED: omega-3 fatty acid desaturase, ch... 155 9e-36 ref|XP_010253759.1| PREDICTED: omega-3 fatty acid desaturase, ch... 155 9e-36 ref|XP_008220937.1| PREDICTED: omega-3 fatty acid desaturase, en... 154 2e-35 ref|XP_007205342.1| hypothetical protein PRUPE_ppa007057mg [Prun... 154 2e-35 ref|XP_011048066.1| PREDICTED: omega-3 fatty acid desaturase, ch... 154 3e-35 emb|CBI25467.3| unnamed protein product [Vitis vinifera] 153 4e-35 ref|XP_007205175.1| hypothetical protein PRUPE_ppa005574mg [Prun... 153 4e-35 ref|XP_002273774.1| PREDICTED: omega-3 fatty acid desaturase, ch... 153 4e-35 gb|AAN17504.1| microsomal omega-3 fatty acid desaturase [Betula ... 153 4e-35 ref|XP_002312163.2| chloroplast omega-3 desaturase family protei... 152 9e-35 ref|XP_009347248.1| PREDICTED: omega-3 fatty acid desaturase, en... 152 1e-34 ref|XP_009338917.1| PREDICTED: omega-3 fatty acid desaturase, en... 152 1e-34 ref|XP_008349666.1| PREDICTED: omega-3 fatty acid desaturase, en... 152 1e-34 ref|XP_008384790.1| PREDICTED: omega-3 fatty acid desaturase, en... 152 1e-34 ref|XP_006481053.1| PREDICTED: omega-3 fatty acid desaturase, ch... 152 1e-34 gb|AEK67592.1| omega-3 fatty acid desaturase [Citrus medica var.... 152 1e-34 emb|CDP14009.1| unnamed protein product [Coffea canephora] 151 2e-34 ref|XP_006429411.1| hypothetical protein CICLE_v10011691mg [Citr... 151 2e-34 ref|XP_006429409.1| hypothetical protein CICLE_v10011691mg [Citr... 151 2e-34 gb|EMT20695.1| Omega-3 fatty acid desaturase, chloroplastic [Aeg... 151 2e-34 >ref|XP_010253760.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like isoform X2 [Nelumbo nucifera] Length = 408 Score = 155 bits (393), Expect = 9e-36 Identities = 66/87 (75%), Positives = 78/87 (89%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF+P+S LF PNER++VI ST+CW+AM ALLV SCV+GP+Q+LKLY VPYW Sbjct: 213 RSPGKTGSHFHPDSDLFAPNERKDVITSTVCWVAMVALLVGLSCVIGPVQMLKLYGVPYW 272 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG++ KLPWYRGK Sbjct: 273 IFVMWLDIVTYLHHHGHEDKLPWYRGK 299 >ref|XP_010253759.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like isoform X1 [Nelumbo nucifera] Length = 462 Score = 155 bits (393), Expect = 9e-36 Identities = 66/87 (75%), Positives = 78/87 (89%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF+P+S LF PNER++VI ST+CW+AM ALLV SCV+GP+Q+LKLY VPYW Sbjct: 267 RSPGKTGSHFHPDSDLFAPNERKDVITSTVCWVAMVALLVGLSCVIGPVQMLKLYGVPYW 326 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG++ KLPWYRGK Sbjct: 327 IFVMWLDIVTYLHHHGHEDKLPWYRGK 353 >ref|XP_008220937.1| PREDICTED: omega-3 fatty acid desaturase, endoplasmic reticulum-like [Prunus mume] Length = 384 Score = 154 bits (389), Expect = 2e-35 Identities = 67/87 (77%), Positives = 74/87 (85%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHFNP S LF PNER++VI ST+CW M ALL+ S VVGP+QILKLY VPYW Sbjct: 189 RSPGKQGSHFNPYSGLFAPNERKDVITSTVCWTMMVALLLYLSYVVGPVQILKLYCVPYW 248 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IF+MW+D VTYLHHHGYDQKLPWYRGK Sbjct: 249 IFIMWIDLVTYLHHHGYDQKLPWYRGK 275 >ref|XP_007205342.1| hypothetical protein PRUPE_ppa007057mg [Prunus persica] gi|462400984|gb|EMJ06541.1| hypothetical protein PRUPE_ppa007057mg [Prunus persica] Length = 384 Score = 154 bits (389), Expect = 2e-35 Identities = 67/87 (77%), Positives = 74/87 (85%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHFNP S LF PNER++VI ST+CW M ALL+ S VVGP+QILKLY VPYW Sbjct: 189 RSPGKQGSHFNPYSDLFAPNERKDVITSTVCWTMMVALLLYLSYVVGPVQILKLYCVPYW 248 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IF+MW+D VTYLHHHGYDQKLPWYRGK Sbjct: 249 IFIMWIDLVTYLHHHGYDQKLPWYRGK 275 >ref|XP_011048066.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic [Populus euphratica] Length = 451 Score = 154 bits (388), Expect = 3e-35 Identities = 67/87 (77%), Positives = 76/87 (87%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHF+P+S LF PNER++VI ST CW AMAALLV S V+GPLQ+LKLY +PYW Sbjct: 258 RSPGKKGSHFHPDSDLFVPNERKDVITSTACWTAMAALLVCLSFVMGPLQVLKLYGIPYW 317 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG+D+KLPWYRGK Sbjct: 318 IFVMWLDLVTYLHHHGHDEKLPWYRGK 344 >emb|CBI25467.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 153 bits (387), Expect = 4e-35 Identities = 66/87 (75%), Positives = 78/87 (89%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF+PNS LF PNER++VI ST+CW AMAALLV S V+GP+Q+LKLY +PYW Sbjct: 256 RSPGKTGSHFDPNSDLFIPNERKDVITSTVCWSAMAALLVCLSFVMGPVQMLKLYGIPYW 315 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG+++KLPWYRGK Sbjct: 316 IFVMWLDLVTYLHHHGHEEKLPWYRGK 342 >ref|XP_007205175.1| hypothetical protein PRUPE_ppa005574mg [Prunus persica] gi|462400817|gb|EMJ06374.1| hypothetical protein PRUPE_ppa005574mg [Prunus persica] Length = 453 Score = 153 bits (387), Expect = 4e-35 Identities = 65/87 (74%), Positives = 78/87 (89%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF+PNS LF PNER++VI ST+CW AMAALLV S V+GP+Q+LKLY +PYW Sbjct: 260 RSPGKTGSHFHPNSDLFVPNERKDVITSTLCWTAMAALLVGLSFVMGPIQLLKLYGIPYW 319 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 +FVMWLD VTYLHHHG+++KLPWYRGK Sbjct: 320 VFVMWLDLVTYLHHHGHEEKLPWYRGK 346 >ref|XP_002273774.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic [Vitis vinifera] Length = 456 Score = 153 bits (387), Expect = 4e-35 Identities = 66/87 (75%), Positives = 78/87 (89%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF+PNS LF PNER++VI ST+CW AMAALLV S V+GP+Q+LKLY +PYW Sbjct: 263 RSPGKTGSHFDPNSDLFIPNERKDVITSTVCWSAMAALLVCLSFVMGPVQMLKLYGIPYW 322 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG+++KLPWYRGK Sbjct: 323 IFVMWLDLVTYLHHHGHEEKLPWYRGK 349 >gb|AAN17504.1| microsomal omega-3 fatty acid desaturase [Betula pendula] Length = 386 Score = 153 bits (387), Expect = 4e-35 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHFNP S+LF PNER++VI ST+CW MAALL+ SSC +GP+Q+LKLY VP+ Sbjct: 191 RSPGKEGSHFNPYSNLFSPNERKDVITSTLCWSLMAALLIYSSCAIGPIQMLKLYGVPHL 250 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHGY+QKLPWYRGK Sbjct: 251 IFVMWLDLVTYLHHHGYEQKLPWYRGK 277 >ref|XP_002312163.2| chloroplast omega-3 desaturase family protein [Populus trichocarpa] gi|550332575|gb|EEE89530.2| chloroplast omega-3 desaturase family protein [Populus trichocarpa] Length = 451 Score = 152 bits (384), Expect = 9e-35 Identities = 66/87 (75%), Positives = 75/87 (86%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHF+P+S LF PNER++VI ST CW AMAALLV S V+GP Q+LKLY +PYW Sbjct: 258 RSPGKKGSHFHPDSDLFVPNERKDVITSTACWTAMAALLVCLSFVMGPFQVLKLYGIPYW 317 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG+D+KLPWYRGK Sbjct: 318 IFVMWLDLVTYLHHHGHDEKLPWYRGK 344 >ref|XP_009347248.1| PREDICTED: omega-3 fatty acid desaturase, endoplasmic reticulum-like [Pyrus x bretschneideri] Length = 447 Score = 152 bits (383), Expect = 1e-34 Identities = 67/87 (77%), Positives = 73/87 (83%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHFNP S LF PNER++VI ST CW M +LLV S VVGP++ILKLY VPYW Sbjct: 252 RSPGKQGSHFNPYSDLFAPNERRDVITSTTCWTMMVSLLVYLSFVVGPVEILKLYGVPYW 311 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHGYD+KLPWYRGK Sbjct: 312 IFVMWLDMVTYLHHHGYDEKLPWYRGK 338 >ref|XP_009338917.1| PREDICTED: omega-3 fatty acid desaturase, endoplasmic reticulum-like [Pyrus x bretschneideri] Length = 388 Score = 152 bits (383), Expect = 1e-34 Identities = 67/87 (77%), Positives = 73/87 (83%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHFNP S LF PNER++VI ST CW M +LLV S V+GPL+ILKLY VPYW Sbjct: 193 RSPGKKGSHFNPYSDLFAPNERRDVIASTTCWTMMVSLLVYLSFVLGPLEILKLYGVPYW 252 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHGYD+KLPWYRGK Sbjct: 253 IFVMWLDMVTYLHHHGYDEKLPWYRGK 279 >ref|XP_008349666.1| PREDICTED: omega-3 fatty acid desaturase, endoplasmic reticulum-like [Malus domestica] Length = 216 Score = 152 bits (383), Expect = 1e-34 Identities = 67/87 (77%), Positives = 73/87 (83%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHFNP S LF PNER++VI ST CW M +LLV S VVGP++ILKLY VPYW Sbjct: 21 RSPGKKGSHFNPYSDLFAPNERRDVIASTTCWTMMVSLLVYLSFVVGPVEILKLYGVPYW 80 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHGYD+KLPWYRGK Sbjct: 81 IFVMWLDMVTYLHHHGYDEKLPWYRGK 107 >ref|XP_008384790.1| PREDICTED: omega-3 fatty acid desaturase, endoplasmic reticulum-like [Malus domestica] Length = 388 Score = 152 bits (383), Expect = 1e-34 Identities = 67/87 (77%), Positives = 73/87 (83%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK GSHFNP S LF PNER++VI ST CW M +LLV S VVGP++ILKLY VPYW Sbjct: 193 RSPGKKGSHFNPYSDLFAPNERRDVIASTTCWTMMVSLLVYLSFVVGPVEILKLYGVPYW 252 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHGYD+KLPWYRGK Sbjct: 253 IFVMWLDMVTYLHHHGYDEKLPWYRGK 279 >ref|XP_006481053.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Citrus sinensis] Length = 457 Score = 152 bits (383), Expect = 1e-34 Identities = 66/87 (75%), Positives = 77/87 (88%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGKSGSHF+PNS LF P+ER++VI ST+CW AMAALLV S V+GP+Q+LKLY +PYW Sbjct: 264 RSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYW 323 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG++ KLPWYRGK Sbjct: 324 IFVMWLDLVTYLHHHGHEDKLPWYRGK 350 >gb|AEK67592.1| omega-3 fatty acid desaturase [Citrus medica var. sarcodactylis] Length = 457 Score = 152 bits (383), Expect = 1e-34 Identities = 66/87 (75%), Positives = 77/87 (88%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF+PNS LF P+ER++VI ST+CW AMAALLV S V+GP+Q+LKLY VPYW Sbjct: 264 RSPGKTGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGVPYW 323 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG++ KLPWYRGK Sbjct: 324 IFVMWLDLVTYLHHHGHEDKLPWYRGK 350 >emb|CDP14009.1| unnamed protein product [Coffea canephora] Length = 327 Score = 151 bits (382), Expect = 2e-34 Identities = 66/87 (75%), Positives = 77/87 (88%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF+P+S LF P+ER +VI ST+CW AMAALLV S V+GP+Q+LKLY VPYW Sbjct: 134 RSPGKTGSHFDPSSDLFVPSERNDVITSTVCWAAMAALLVGLSFVMGPVQLLKLYGVPYW 193 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG+D+KLPWYRGK Sbjct: 194 IFVMWLDLVTYLHHHGHDEKLPWYRGK 220 >ref|XP_006429411.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] gi|567873645|ref|XP_006429412.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] gi|557531468|gb|ESR42651.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] gi|557531469|gb|ESR42652.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] Length = 354 Score = 151 bits (382), Expect = 2e-34 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF PNS LF P+ER++VI ST+CW AMAALLV S V+GP+Q+LKLY VPYW Sbjct: 264 RSPGKTGSHFEPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGVPYW 323 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG++ KLPWYRGK Sbjct: 324 IFVMWLDLVTYLHHHGHEDKLPWYRGK 350 >ref|XP_006429409.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] gi|557531466|gb|ESR42649.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] Length = 457 Score = 151 bits (382), Expect = 2e-34 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGK+GSHF PNS LF P+ER++VI ST+CW AMAALLV S V+GP+Q+LKLY VPYW Sbjct: 264 RSPGKTGSHFEPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGVPYW 323 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG++ KLPWYRGK Sbjct: 324 IFVMWLDLVTYLHHHGHEDKLPWYRGK 350 >gb|EMT20695.1| Omega-3 fatty acid desaturase, chloroplastic [Aegilops tauschii] Length = 371 Score = 151 bits (382), Expect = 2e-34 Identities = 65/87 (74%), Positives = 77/87 (88%) Frame = -1 Query: 262 RSPGKSGSHFNPNSSLFQPNERQEVIVSTICWLAMAALLVVSSCVVGPLQILKLYSVPYW 83 RSPGKSGSHF+P+S LFQPNE+++++ ST CWLAMA LL + V+GPLQILKLY+VPYW Sbjct: 177 RSPGKSGSHFHPSSDLFQPNEKKDIVTSTTCWLAMAGLLAGLTVVMGPLQILKLYAVPYW 236 Query: 82 IFVMWLDTVTYLHHHGYDQKLPWYRGK 2 IFVMWLD VTYLHHHG++ KLPWYRGK Sbjct: 237 IFVMWLDFVTYLHHHGHNDKLPWYRGK 263