BLASTX nr result
ID: Aconitum23_contig00018340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00018340 (675 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010264451.1| PREDICTED: uncharacterized protein LOC104602... 65 4e-08 ref|XP_010264450.1| PREDICTED: uncharacterized protein LOC104602... 65 4e-08 ref|XP_011658162.1| PREDICTED: methyl-CpG-binding domain-contain... 63 2e-07 ref|XP_008457481.1| PREDICTED: methyl-CpG-binding domain-contain... 63 2e-07 gb|KCW52682.1| hypothetical protein EUGRSUZ_J02050 [Eucalyptus g... 61 7e-07 ref|XP_010033125.1| PREDICTED: methyl-CpG-binding domain-contain... 61 7e-07 emb|CDX88699.1| BnaA03g09500D [Brassica napus] 60 2e-06 ref|XP_002864630.1| hypothetical protein ARALYDRAFT_919168 [Arab... 60 2e-06 ref|XP_009345984.1| PREDICTED: methyl-CpG-binding domain-contain... 59 3e-06 gb|KFK27470.1| hypothetical protein AALP_AA8G387500 [Arabis alpina] 59 3e-06 gb|KFK27467.1| hypothetical protein AALP_AA8G387100 [Arabis alpina] 59 3e-06 ref|XP_006280964.1| hypothetical protein CARUB_v10026965mg, part... 59 3e-06 ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-contain... 59 3e-06 ref|XP_011625334.1| PREDICTED: uncharacterized protein LOC184230... 58 5e-06 ref|XP_006827729.1| PREDICTED: uncharacterized protein LOC184230... 58 5e-06 ref|XP_006362862.1| PREDICTED: methyl-CpG-binding domain-contain... 58 6e-06 gb|ALO02507.1| MBD5 [Solanum lycopersicum] 57 8e-06 ref|XP_011624098.1| PREDICTED: methyl-CpG-binding domain-contain... 57 8e-06 ref|XP_011624097.1| PREDICTED: uncharacterized protein LOC184360... 57 8e-06 ref|XP_011624096.1| PREDICTED: uncharacterized protein LOC184360... 57 8e-06 >ref|XP_010264451.1| PREDICTED: uncharacterized protein LOC104602459 isoform X2 [Nelumbo nucifera] Length = 303 Score = 65.1 bits (157), Expect = 4e-08 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 4/65 (6%) Frame = +1 Query: 154 GLSKAIVSTH---PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFL 321 GL AIV P+WLP GWRME + R G AG ++++YDP + +RSKREVL FL Sbjct: 145 GLELAIVPASQDLPDWLPPGWRMESRVRSSGVTAGMRDRYFYDPVSGRQFRSKREVLCFL 204 Query: 322 DTGMS 336 +TGMS Sbjct: 205 ETGMS 209 >ref|XP_010264450.1| PREDICTED: uncharacterized protein LOC104602459 isoform X1 [Nelumbo nucifera] Length = 304 Score = 65.1 bits (157), Expect = 4e-08 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 4/65 (6%) Frame = +1 Query: 154 GLSKAIVSTH---PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFL 321 GL AIV P+WLP GWRME + R G AG ++++YDP + +RSKREVL FL Sbjct: 145 GLELAIVPASQDLPDWLPPGWRMESRVRSSGVTAGMRDRYFYDPVSGRQFRSKREVLCFL 204 Query: 322 DTGMS 336 +TGMS Sbjct: 205 ETGMS 209 >ref|XP_011658162.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Cucumis sativus] gi|700210628|gb|KGN65724.1| hypothetical protein Csa_1G522010 [Cucumis sativus] Length = 278 Score = 62.8 bits (151), Expect = 2e-07 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +1 Query: 160 SKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 SK+ +S P WLP GW +E + R G AG ++K+Y+DP +N +RSK EVL FL+TG Sbjct: 133 SKSALSERPNWLPPGWVVEDRVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLETG 190 >ref|XP_008457481.1| PREDICTED: methyl-CpG-binding domain-containing protein 5 [Cucumis melo] Length = 280 Score = 62.8 bits (151), Expect = 2e-07 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +1 Query: 160 SKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 SK+ +S P WLP GW +E + R G AG ++K+Y+DP +N +RSK EVL FL+TG Sbjct: 135 SKSALSERPNWLPPGWVVEDRVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLETG 192 >gb|KCW52682.1| hypothetical protein EUGRSUZ_J02050 [Eucalyptus grandis] Length = 237 Score = 60.8 bits (146), Expect = 7e-07 Identities = 33/80 (41%), Positives = 50/80 (62%), Gaps = 6/80 (7%) Frame = +1 Query: 115 ALPP-PEGLLNVGEGLSK----AIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDPN 279 A+PP PE + + S+ +++ P+WLP GW +E + R G AG +K+Y DP Sbjct: 105 AVPPTPENASSADDPSSRRKTRVVLAETPDWLPAGWYVEDRVRTSGVTAGTRDKYYCDPV 164 Query: 280 NH-LYRSKREVLEFLDTGMS 336 +H ++RSK+EVL FL+TG S Sbjct: 165 SHRVFRSKKEVLYFLETGFS 184 >ref|XP_010033125.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Eucalyptus grandis] gi|629086324|gb|KCW52681.1| hypothetical protein EUGRSUZ_J02050 [Eucalyptus grandis] Length = 282 Score = 60.8 bits (146), Expect = 7e-07 Identities = 33/80 (41%), Positives = 50/80 (62%), Gaps = 6/80 (7%) Frame = +1 Query: 115 ALPP-PEGLLNVGEGLSK----AIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDPN 279 A+PP PE + + S+ +++ P+WLP GW +E + R G AG +K+Y DP Sbjct: 105 AVPPTPENASSADDPSSRRKTRVVLAETPDWLPAGWYVEDRVRTSGVTAGTRDKYYCDPV 164 Query: 280 NH-LYRSKREVLEFLDTGMS 336 +H ++RSK+EVL FL+TG S Sbjct: 165 SHRVFRSKKEVLYFLETGFS 184 >emb|CDX88699.1| BnaA03g09500D [Brassica napus] Length = 178 Score = 59.7 bits (143), Expect = 2e-06 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 1/73 (1%) Frame = +1 Query: 121 PPPEGLLNVGEGLSKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRS 297 PPP+ E S+ + WLP GWR+E K R G AG ++K+YY+P +RS Sbjct: 10 PPPDNSAQQSESKSRKRSAPLDNWLPDGWRVEDKVRTSGAKAGSVDKYYYEPVTGRRFRS 69 Query: 298 KREVLEFLDTGMS 336 + EVL +L+ G S Sbjct: 70 RTEVLYYLEHGTS 82 >ref|XP_002864630.1| hypothetical protein ARALYDRAFT_919168 [Arabidopsis lyrata subsp. lyrata] gi|297310465|gb|EFH40889.1| hypothetical protein ARALYDRAFT_919168 [Arabidopsis lyrata subsp. lyrata] Length = 233 Score = 59.7 bits (143), Expect = 2e-06 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +1 Query: 121 PPPEGLLNVGEGLSKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDPN-NHLYRS 297 P P+ + E S+ + WLP GWR+E K R G AG ++K+YY+PN +RS Sbjct: 64 PSPDSSSHQAESKSRKRAAPGDNWLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRS 123 Query: 298 KREVLEFLDTGMS 336 + EVL +L+ G S Sbjct: 124 RTEVLYYLEHGTS 136 >ref|XP_009345984.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Pyrus x bretschneideri] Length = 234 Score = 58.9 bits (141), Expect = 3e-06 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +1 Query: 148 GEGLSKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLD 324 G G KA + WLPQGW ++ K R G AG +++Y DP + +RSK EVL FL+ Sbjct: 86 GRGKRKAFTDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLE 145 Query: 325 TG 330 TG Sbjct: 146 TG 147 >gb|KFK27470.1| hypothetical protein AALP_AA8G387500 [Arabis alpina] Length = 226 Score = 58.9 bits (141), Expect = 3e-06 Identities = 28/70 (40%), Positives = 37/70 (52%) Frame = +1 Query: 121 PPPEGLLNVGEGLSKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDPNNHLYRSK 300 P P E S+ + WLP GWR+E K R G AG +++YY P H +RSK Sbjct: 56 PSPINWARQAESNSRKRAAPGDSWLPPGWRIEDKVRTSGATAGIRDRYYYSPGGHKFRSK 115 Query: 301 REVLEFLDTG 330 EVL +L+ G Sbjct: 116 TEVLHYLEHG 125 >gb|KFK27467.1| hypothetical protein AALP_AA8G387100 [Arabis alpina] Length = 205 Score = 58.9 bits (141), Expect = 3e-06 Identities = 28/70 (40%), Positives = 37/70 (52%) Frame = +1 Query: 121 PPPEGLLNVGEGLSKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDPNNHLYRSK 300 P P E S+ + WLP GWR+E K R G AG +++YY P H +RSK Sbjct: 29 PSPINWARQAESNSRKRAAPGDSWLPPGWRIEDKVRTSGATAGIRDRYYYSPGGHKFRSK 88 Query: 301 REVLEFLDTG 330 EVL +L+ G Sbjct: 89 TEVLHYLEHG 98 >ref|XP_006280964.1| hypothetical protein CARUB_v10026965mg, partial [Capsella rubella] gi|482549668|gb|EOA13862.1| hypothetical protein CARUB_v10026965mg, partial [Capsella rubella] Length = 263 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 1/73 (1%) Frame = +1 Query: 121 PPPEGLLNVGEGLSKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDPN-NHLYRS 297 PP + + E S+ + WLP GWR+E K R G AG ++K+YY+PN +RS Sbjct: 95 PPQDSSGHQSESKSRKRAAPGDNWLPSGWRVEDKVRTSGATAGSVDKYYYEPNTGRKFRS 154 Query: 298 KREVLEFLDTGMS 336 + EVL +L G S Sbjct: 155 RTEVLYYLQHGTS 167 >ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Fragaria vesca subsp. vesca] Length = 209 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +1 Query: 142 NVGEGLSKAIVSTHPEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEF 318 + G +K +WLP GWR+E K R G AG +++Y+DP + +RSK+EVL F Sbjct: 58 SAGRAKAKGSDPMSMDWLPAGWRVEYKVRSSGATAGSTDRYYHDPVSGRRFRSKKEVLHF 117 Query: 319 LDTG 330 L+TG Sbjct: 118 LETG 121 >ref|XP_011625334.1| PREDICTED: uncharacterized protein LOC18423079 isoform X1 [Amborella trichopoda] Length = 1291 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 184 PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 PEWLP GW ME+KERK GK AG EK+Y DP +RS+ ++ +++ G Sbjct: 654 PEWLPPGWTMEIKERKSGKSAGLREKYYIDPATGRSFRSRIAIVRYIEAG 703 >ref|XP_006827729.1| PREDICTED: uncharacterized protein LOC18423079 isoform X2 [Amborella trichopoda] gi|548832349|gb|ERM95145.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda] Length = 1239 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 184 PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 PEWLP GW ME+KERK GK AG EK+Y DP +RS+ ++ +++ G Sbjct: 654 PEWLPPGWTMEIKERKSGKSAGLREKYYIDPATGRSFRSRIAIVRYIEAG 703 >ref|XP_006362862.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Solanum tuberosum] Length = 245 Score = 57.8 bits (138), Expect = 6e-06 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 184 PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 P WLP+ WR E K R G AG ++++YY+P + +RSK EVL FL+TG Sbjct: 99 PTWLPESWRFEAKVRTSGATAGTVDRYYYEPVSGSKFRSKTEVLYFLETG 148 >gb|ALO02507.1| MBD5 [Solanum lycopersicum] Length = 248 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = +1 Query: 184 PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 P WLP+ WR E K R G AG ++++YY+P +RSK EVL FL+TG Sbjct: 99 PTWLPESWRFEAKVRTSGATAGTVDRYYYEPVTGSKFRSKTEVLYFLETG 148 >ref|XP_011624098.1| PREDICTED: methyl-CpG-binding domain-containing protein 5 isoform X3 [Amborella trichopoda] Length = 273 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 184 PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 P+WLP GW E+K R G AG +K++YDP + +RSK+EV FL+TG Sbjct: 125 PDWLPAGWITEIKVRANGLTAGTKDKYFYDPVSKRKFRSKKEVFSFLETG 174 >ref|XP_011624097.1| PREDICTED: uncharacterized protein LOC18436098 isoform X2 [Amborella trichopoda] Length = 349 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 184 PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 P+WLP GW E+K R G AG +K++YDP + +RSK+EV FL+TG Sbjct: 125 PDWLPAGWITEIKVRANGLTAGTKDKYFYDPVSKRKFRSKKEVFSFLETG 174 >ref|XP_011624096.1| PREDICTED: uncharacterized protein LOC18436098 isoform X1 [Amborella trichopoda] Length = 383 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 184 PEWLPQGWRMELKERKRGKLAGRIEKFYYDP-NNHLYRSKREVLEFLDTG 330 P+WLP GW E+K R G AG +K++YDP + +RSK+EV FL+TG Sbjct: 125 PDWLPAGWITEIKVRANGLTAGTKDKYFYDPVSKRKFRSKKEVFSFLETG 174