BLASTX nr result
ID: Aconitum23_contig00017445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00017445 (365 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012081168.1| PREDICTED: uncharacterized protein LOC105641... 60 6e-07 ref|XP_010096989.1| hypothetical protein L484_024912 [Morus nota... 59 1e-06 ref|XP_007013585.1| Uncharacterized protein TCM_038176 [Theobrom... 57 4e-06 >ref|XP_012081168.1| PREDICTED: uncharacterized protein LOC105641270 [Jatropha curcas] gi|643719361|gb|KDP30231.1| hypothetical protein JCGZ_17013 [Jatropha curcas] Length = 393 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/58 (56%), Positives = 38/58 (65%) Frame = -1 Query: 179 KEESQQVLKVLEALKQASQDIHXXXXXXXXXXXXXPIKALLELQSEADNILSNDPNLS 6 KEE +VLKVLEALKQAS D+ IKALLEL++E+D ILS DPNLS Sbjct: 7 KEEISRVLKVLEALKQASHDLQLHPTPKSTDSNSPAIKALLELETESDTILSKDPNLS 64 >ref|XP_010096989.1| hypothetical protein L484_024912 [Morus notabilis] gi|587877581|gb|EXB66616.1| hypothetical protein L484_024912 [Morus notabilis] Length = 410 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = -1 Query: 179 KEESQQVLKVLEALKQASQDIHXXXXXXXXXXXXXPIKALLELQSEADNILSNDPNLS 6 K E+ +VLKVLEALKQAS+D+ IKALLEL++E+D ILS DPNLS Sbjct: 6 KRETPRVLKVLEALKQASRDLQAHPSPDSDDSNSSAIKALLELETESDTILSKDPNLS 63 >ref|XP_007013585.1| Uncharacterized protein TCM_038176 [Theobroma cacao] gi|508783948|gb|EOY31204.1| Uncharacterized protein TCM_038176 [Theobroma cacao] Length = 393 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = -1 Query: 179 KEESQQVLKVLEALKQASQDIHXXXXXXXXXXXXXPIKALLELQSEADNILSNDPNL 9 KE++ +VLKVLEALKQAS ++ IKALLEL++E+D+ILSNDP+L Sbjct: 7 KEDNPRVLKVLEALKQASHELQAHPTYKSANSNSSAIKALLELETESDSILSNDPHL 63