BLASTX nr result
ID: Aconitum23_contig00017397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00017397 (362 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW67885.1| hypothetical protein EUGRSUZ_F01596 [Eucalyptus g... 57 5e-06 ref|XP_008811088.1| PREDICTED: bifunctional nuclease 2-like isof... 57 7e-06 >gb|KCW67885.1| hypothetical protein EUGRSUZ_F01596 [Eucalyptus grandis] Length = 329 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 1 RPDGKPSVEAEEFDLVRNMVIAVVEERYRDAGM 99 RP G+P +E +EFDLVRNM+IA VEERYRDAGM Sbjct: 280 RPSGQPCIETKEFDLVRNMLIAAVEERYRDAGM 312 >ref|XP_008811088.1| PREDICTED: bifunctional nuclease 2-like isoform X2 [Phoenix dactylifera] Length = 327 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 1 RPDGKPSVEAEEFDLVRNMVIAVVEERYRDAGMI 102 RPDG+P +E++EFDL+RNM+IA VEERY+DAG I Sbjct: 282 RPDGQPCLESKEFDLIRNMLIAAVEERYKDAGKI 315