BLASTX nr result
ID: Aconitum23_contig00016982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00016982 (420 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO68823.1| hypothetical protein CISIN_1g015430mg [Citrus sin... 99 1e-18 ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citr... 99 1e-18 ref|XP_010652109.1| PREDICTED: BTB/POZ and MATH domain-containin... 97 4e-18 gb|KJB22576.1| hypothetical protein B456_004G055100 [Gossypium r... 97 5e-18 ref|XP_012473531.1| PREDICTED: BTB/POZ and MATH domain-containin... 97 5e-18 gb|KHG07672.1| BTB/POZ and MATH domain-containing 2 -like protei... 97 5e-18 ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 97 5e-18 ref|XP_011082543.1| PREDICTED: BTB/POZ and MATH domain-containin... 96 8e-18 ref|XP_011079801.1| PREDICTED: BTB/POZ and MATH domain-containin... 96 8e-18 ref|XP_012832653.1| PREDICTED: BTB/POZ and MATH domain-containin... 96 8e-18 ref|XP_010695312.1| PREDICTED: BTB/POZ and MATH domain-containin... 94 2e-17 ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containin... 95 2e-17 ref|XP_012092297.1| PREDICTED: BTB/POZ and MATH domain-containin... 95 2e-17 ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus ... 95 2e-17 ref|XP_012490512.1| PREDICTED: BTB/POZ and MATH domain-containin... 95 2e-17 gb|KHG23818.1| BTB/POZ and MATH domain-containing 2 -like protei... 95 2e-17 ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containin... 95 2e-17 ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containin... 95 2e-17 ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citr... 95 2e-17 ref|XP_010255860.1| PREDICTED: BTB/POZ and MATH domain-containin... 94 3e-17 >gb|KDO68823.1| hypothetical protein CISIN_1g015430mg [Citrus sinensis] Length = 399 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS Sbjct: 34 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 78 >ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] gi|568852211|ref|XP_006479773.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] gi|557546400|gb|ESR57378.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] gi|641849948|gb|KDO68822.1| hypothetical protein CISIN_1g015430mg [Citrus sinensis] Length = 407 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS Sbjct: 34 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 78 >ref|XP_010652109.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vitis vinifera] gi|296086694|emb|CBI32329.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 97.4 bits (241), Expect = 4e-18 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTF+VGGYAWAIYFYPDGKS Sbjct: 29 NGSHQFKITGYSLSKGLGIGKYIASDTFVVGGYAWAIYFYPDGKS 73 >gb|KJB22576.1| hypothetical protein B456_004G055100 [Gossypium raimondii] Length = 357 Score = 97.1 bits (240), Expect = 5e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGY WAIYFYPDGKS Sbjct: 33 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLWAIYFYPDGKS 77 >ref|XP_012473531.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Gossypium raimondii] gi|763755244|gb|KJB22575.1| hypothetical protein B456_004G055100 [Gossypium raimondii] Length = 406 Score = 97.1 bits (240), Expect = 5e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGY WAIYFYPDGKS Sbjct: 33 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLWAIYFYPDGKS 77 >gb|KHG07672.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium arboreum] Length = 405 Score = 97.1 bits (240), Expect = 5e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGY WAIYFYPDGKS Sbjct: 33 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLWAIYFYPDGKS 77 >ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508702947|gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 493 Score = 97.1 bits (240), Expect = 5e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGY WAIYFYPDGKS Sbjct: 33 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLWAIYFYPDGKS 77 >ref|XP_011082543.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Sesamum indicum] Length = 410 Score = 96.3 bits (238), Expect = 8e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSH FKITGYSLSKG+GIGKYIASDTFMVGGYAWAIYFYPDGKS Sbjct: 37 NGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYAWAIYFYPDGKS 81 >ref|XP_011079801.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Sesamum indicum] Length = 410 Score = 96.3 bits (238), Expect = 8e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSH FKITGYSLSKG+GIGKYIASDTFMVGGYAWAIYFYPDGKS Sbjct: 37 NGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYAWAIYFYPDGKS 81 >ref|XP_012832653.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Erythranthe guttatus] gi|604348468|gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Erythranthe guttata] Length = 410 Score = 96.3 bits (238), Expect = 8e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSH FKITGYSLSKG+GIGKYIASDTFMVGGYAWAIYFYPDGKS Sbjct: 37 NGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYAWAIYFYPDGKS 81 >ref|XP_010695312.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Beta vulgaris subsp. vulgaris] gi|870844883|gb|KMS97745.1| hypothetical protein BVRB_5g124170 [Beta vulgaris subsp. vulgaris] Length = 405 Score = 94.0 bits (232), Expect(2) = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSH+FKI GYSLSKGLGIGKYIASDTFMVGGY WAIYFYPDGKS Sbjct: 30 NGSHEFKINGYSLSKGLGIGKYIASDTFMVGGYLWAIYFYPDGKS 74 Score = 21.9 bits (45), Expect(2) = 2e-17 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 235 KTLNNSHEFNLN 270 +T+N SHEF +N Sbjct: 27 ETINGSHEFKIN 38 >ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Nicotiana tomentosiformis] Length = 411 Score = 95.1 bits (235), Expect = 2e-17 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSH FKITGYSLSKG+GIGKYIASDTFMVGGY+WAIYFYPDGKS Sbjct: 38 NGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYSWAIYFYPDGKS 82 >ref|XP_012092297.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Jatropha curcas] gi|643704439|gb|KDP21503.1| hypothetical protein JCGZ_21974 [Jatropha curcas] Length = 407 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTF VGGY+WAIYFYPDGKS Sbjct: 34 NGSHQFKITGYSLSKGLGIGKYIASDTFNVGGYSWAIYFYPDGKS 78 >ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus communis] gi|223535995|gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus communis] Length = 500 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASDTF VGGY+WAIYFYPDGKS Sbjct: 40 NGSHQFKITGYSLSKGLGIGKYIASDTFNVGGYSWAIYFYPDGKS 84 >ref|XP_012490512.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Gossypium raimondii] gi|763774922|gb|KJB42045.1| hypothetical protein B456_007G134100 [Gossypium raimondii] Length = 403 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKG GIGKYIASDTFMVGGY WAIYFYPDGKS Sbjct: 30 NGSHQFKITGYSLSKGSGIGKYIASDTFMVGGYLWAIYFYPDGKS 74 >gb|KHG23818.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium arboreum] Length = 402 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKG GIGKYIASDTFMVGGY WAIYFYPDGKS Sbjct: 30 NGSHQFKITGYSLSKGSGIGKYIASDTFMVGGYLWAIYFYPDGKS 74 >ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum lycopersicum] Length = 412 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSH FKITGYSLSKG+GIGKYIASDTFMVGGY WAIYFYPDGKS Sbjct: 39 NGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYTWAIYFYPDGKS 83 >ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] gi|641856084|gb|KDO74864.1| hypothetical protein CISIN_1g015649mg [Citrus sinensis] Length = 403 Score = 94.7 bits (234), Expect = 2e-17 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKI+GYSLSKG+GIGKYIASDTF+VGGYAWA+YFYPDGKS Sbjct: 29 NGSHQFKISGYSLSKGMGIGKYIASDTFIVGGYAWAVYFYPDGKS 73 >ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] gi|557521655|gb|ESR33022.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] Length = 403 Score = 94.7 bits (234), Expect = 2e-17 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKI+GYSLSKG+GIGKYIASDTF+VGGYAWA+YFYPDGKS Sbjct: 29 NGSHQFKISGYSLSKGMGIGKYIASDTFIVGGYAWAVYFYPDGKS 73 >ref|XP_010255860.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform X2 [Nelumbo nucifera] Length = 363 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = +2 Query: 284 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWAIYFYPDGKS 418 NGSHQFKITGYSLSKGLGIGKYIASD F VGGYAWAIYFYPDGKS Sbjct: 32 NGSHQFKITGYSLSKGLGIGKYIASDIFWVGGYAWAIYFYPDGKS 76