BLASTX nr result
ID: Aconitum23_contig00016921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00016921 (635 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011031876.1| PREDICTED: protein arginine N-methyltransfer... 57 9e-06 >ref|XP_011031876.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Populus euphratica] Length = 743 Score = 57.0 bits (136), Expect = 9e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -1 Query: 635 DSRYHKQGVKLLRTPVAVNGNGICNSSEYCSVELETYFNPSDGEITVKHIF 483 D RY KQGVKLL PVAV G G+ + CS +E +F+PS GE+ VKH++ Sbjct: 693 DERYWKQGVKLLSQPVAVGGRGL-GTGYCCSTLIEAFFDPSSGELIVKHVW 742