BLASTX nr result
ID: Aconitum23_contig00016731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00016731 (1745 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37015.3| unnamed protein product [Vitis vinifera] 64 3e-07 ref|XP_002280035.1| PREDICTED: autophagy-related protein 8i [Vit... 64 3e-07 ref|XP_006298681.1| hypothetical protein CARUB_v10014774mg, part... 62 1e-06 ref|XP_010091409.1| hypothetical protein L484_013864 [Morus nota... 62 2e-06 gb|KFK38100.1| hypothetical protein AALP_AA3G069400 [Arabis alpina] 62 2e-06 ref|XP_012834751.1| PREDICTED: autophagy-related protein 8i [Ery... 62 2e-06 ref|XP_009359771.1| PREDICTED: autophagy-related protein 8i-like... 62 2e-06 ref|XP_009134896.1| PREDICTED: autophagy-related protein 8h [Bra... 62 2e-06 gb|AID50965.1| autophagy-related protein 8i [Malus domestica] 62 2e-06 ref|XP_008390497.1| PREDICTED: autophagy-related protein 8i-like... 62 2e-06 ref|XP_006444590.1| hypothetical protein CICLE_v10022874mg [Citr... 62 2e-06 ref|NP_001275429.1| autophagy-related protein 8i-like [Solanum t... 62 2e-06 ref|XP_002884578.1| hypothetical protein ARALYDRAFT_477945 [Arab... 62 2e-06 ref|XP_010439795.1| PREDICTED: autophagy-related protein 8h [Cam... 61 3e-06 ref|XP_008223519.1| PREDICTED: autophagy-related protein 8i-like... 61 3e-06 ref|XP_006407948.1| hypothetical protein EUTSA_v10021784mg [Eutr... 61 3e-06 ref|XP_007223493.1| hypothetical protein PRUPE_ppa013518mg [Prun... 61 3e-06 ref|NP_566283.1| autophagy-related protein 8h [Arabidopsis thali... 61 3e-06 dbj|BAJ34055.1| unnamed protein product [Thellungiella halophila] 61 3e-06 gb|AAF08574.1|AC011623_7 hypothetical protein [Arabidopsis thali... 61 3e-06 >emb|CBI37015.3| unnamed protein product [Vitis vinifera] Length = 124 Score = 64.3 bits (155), Expect = 3e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 EERLEES I+AKYPDRVPVIAE+YS +DLPEMEKK Sbjct: 11 EERLEESRDIIAKYPDRVPVIAERYSKTDLPEMEKK 46 >ref|XP_002280035.1| PREDICTED: autophagy-related protein 8i [Vitis vinifera] Length = 129 Score = 64.3 bits (155), Expect = 3e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 EERLEES I+AKYPDRVPVIAE+YS +DLPEMEKK Sbjct: 16 EERLEESRDIIAKYPDRVPVIAERYSKTDLPEMEKK 51 >ref|XP_006298681.1| hypothetical protein CARUB_v10014774mg, partial [Capsella rubella] gi|482567390|gb|EOA31579.1| hypothetical protein CARUB_v10014774mg, partial [Capsella rubella] Length = 173 Score = 62.4 bits (150), Expect = 1e-06 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKKNKY 1628 EERL+ES I+AKYPDRVPVI EKYS++DLP+ME KNKY Sbjct: 69 EERLKESKNIIAKYPDRVPVIIEKYSNADLPDME-KNKY 106 >ref|XP_010091409.1| hypothetical protein L484_013864 [Morus notabilis] gi|587854383|gb|EXB44446.1| hypothetical protein L484_013864 [Morus notabilis] Length = 127 Score = 62.0 bits (149), Expect = 2e-06 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 ++RL+ES ILAKYPDRVPVIAEK+S SDLPEMEKK Sbjct: 14 DQRLDESRDILAKYPDRVPVIAEKHSGSDLPEMEKK 49 >gb|KFK38100.1| hypothetical protein AALP_AA3G069400 [Arabis alpina] Length = 119 Score = 62.0 bits (149), Expect = 2e-06 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKKNKY 1628 +ERL+ES ILAKYPDRVPVI EKYS++DLP+ME KNKY Sbjct: 15 DERLKESKNILAKYPDRVPVIIEKYSNADLPDME-KNKY 52 >ref|XP_012834751.1| PREDICTED: autophagy-related protein 8i [Erythranthe guttatus] gi|604348715|gb|EYU46870.1| hypothetical protein MIMGU_mgv1a016264mg [Erythranthe guttata] Length = 128 Score = 62.0 bits (149), Expect = 2e-06 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 +ERL+ES I+AKYPDRVPV+AE+Y+ SDLPEMEKK Sbjct: 16 DERLQESKDIIAKYPDRVPVVAERYTKSDLPEMEKK 51 >ref|XP_009359771.1| PREDICTED: autophagy-related protein 8i-like [Pyrus x bretschneideri] Length = 118 Score = 61.6 bits (148), Expect = 2e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 +ERLEES I+AKYPDRVPVI E+YS +DLPEMEKK Sbjct: 14 DERLEESKSIIAKYPDRVPVILERYSRTDLPEMEKK 49 >ref|XP_009134896.1| PREDICTED: autophagy-related protein 8h [Brassica rapa] gi|923600259|ref|XP_013740921.1| PREDICTED: autophagy-related protein 8h-like [Brassica napus] gi|674959399|emb|CDX74104.1| BnaA03g29430D [Brassica napus] Length = 119 Score = 61.6 bits (148), Expect = 2e-06 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEK 1640 EERL+ESS I+AKYPDRVPVI EKYS++DLP+MEK Sbjct: 15 EERLKESSNIIAKYPDRVPVIIEKYSNADLPDMEK 49 >gb|AID50965.1| autophagy-related protein 8i [Malus domestica] Length = 118 Score = 61.6 bits (148), Expect = 2e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 +ERLEES I+AKYPDRVPVI E+YS +DLPEMEKK Sbjct: 14 DERLEESKSIIAKYPDRVPVIIERYSRTDLPEMEKK 49 >ref|XP_008390497.1| PREDICTED: autophagy-related protein 8i-like [Malus domestica] Length = 118 Score = 61.6 bits (148), Expect = 2e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 +ERLEES I+AKYPDRVPVI E+YS +DLPEMEKK Sbjct: 14 DERLEESKSIIAKYPDRVPVIIERYSRTDLPEMEKK 49 >ref|XP_006444590.1| hypothetical protein CICLE_v10022874mg [Citrus clementina] gi|568878843|ref|XP_006492394.1| PREDICTED: autophagy-related protein 8i-like [Citrus sinensis] gi|557546852|gb|ESR57830.1| hypothetical protein CICLE_v10022874mg [Citrus clementina] gi|641868160|gb|KDO86844.1| hypothetical protein CISIN_1g033214mg [Citrus sinensis] Length = 125 Score = 61.6 bits (148), Expect = 2e-06 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 E+RLEES I+AKYPDRVPVIAE+YS +DLP+MEKK Sbjct: 14 EQRLEESREIIAKYPDRVPVIAERYSKADLPDMEKK 49 >ref|NP_001275429.1| autophagy-related protein 8i-like [Solanum tuberosum] gi|413968534|gb|AFW90604.1| autophagy 8h [Solanum tuberosum] Length = 119 Score = 61.6 bits (148), Expect = 2e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 EERL ES I+AKYPDRVPV+AE+YS +DLPEMEKK Sbjct: 12 EERLAESRDIIAKYPDRVPVVAERYSKTDLPEMEKK 47 >ref|XP_002884578.1| hypothetical protein ARALYDRAFT_477945 [Arabidopsis lyrata subsp. lyrata] gi|297330418|gb|EFH60837.1| hypothetical protein ARALYDRAFT_477945 [Arabidopsis lyrata subsp. lyrata] Length = 119 Score = 61.6 bits (148), Expect = 2e-06 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKKNKY 1628 +ERL+ES+ I+AKYPDRVPVI EKYS++DLP+ME KNKY Sbjct: 15 DERLKESTNIIAKYPDRVPVIIEKYSNADLPDME-KNKY 52 >ref|XP_010439795.1| PREDICTED: autophagy-related protein 8h [Camelina sativa] gi|727582578|ref|XP_010464214.1| PREDICTED: autophagy-related protein 8h [Camelina sativa] Length = 119 Score = 61.2 bits (147), Expect = 3e-06 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKKNKY 1628 +ERL+ES I+AKYPDRVPVI EKYS++DLP+ME KNKY Sbjct: 15 DERLKESKNIIAKYPDRVPVIIEKYSNADLPDME-KNKY 52 >ref|XP_008223519.1| PREDICTED: autophagy-related protein 8i-like [Prunus mume] Length = 124 Score = 61.2 bits (147), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 +ERLEES I+AKYPDR+PVI E+YS +DLPEMEKK Sbjct: 20 DERLEESKSIIAKYPDRIPVIIERYSRTDLPEMEKK 55 >ref|XP_006407948.1| hypothetical protein EUTSA_v10021784mg [Eutrema salsugineum] gi|557109094|gb|ESQ49401.1| hypothetical protein EUTSA_v10021784mg [Eutrema salsugineum] Length = 119 Score = 61.2 bits (147), Expect = 3e-06 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKKNKY 1628 +ERL+ES I+AKYPDRVPVI EKYS++DLP+ME KNKY Sbjct: 15 DERLKESKNIIAKYPDRVPVIIEKYSNADLPDME-KNKY 52 >ref|XP_007223493.1| hypothetical protein PRUPE_ppa013518mg [Prunus persica] gi|462420429|gb|EMJ24692.1| hypothetical protein PRUPE_ppa013518mg [Prunus persica] Length = 118 Score = 61.2 bits (147), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKK 1637 +ERLEES I+AKYPDR+PVI E+YS +DLPEMEKK Sbjct: 14 DERLEESKSIIAKYPDRIPVIIERYSRTDLPEMEKK 49 >ref|NP_566283.1| autophagy-related protein 8h [Arabidopsis thaliana] gi|75160542|sp|Q8S925.1|ATG8H_ARATH RecName: Full=Autophagy-related protein 8h; AltName: Full=Autophagy-related ubiquitin-like modifier ATG8h; Short=AtAPG8h; Short=Protein autophagy 8h gi|19912165|dbj|BAB88394.1| autophagy 8h [Arabidopsis thaliana] gi|21553409|gb|AAM62502.1| symbiosis-related like protein [Arabidopsis thaliana] gi|51968720|dbj|BAD43052.1| unknown protein [Arabidopsis thaliana] gi|51970516|dbj|BAD43950.1| unknown protein [Arabidopsis thaliana] gi|51971511|dbj|BAD44420.1| unknown protein [Arabidopsis thaliana] gi|88011118|gb|ABD38905.1| At3g06420 [Arabidopsis thaliana] gi|332640869|gb|AEE74390.1| autophagy-related protein 8h [Arabidopsis thaliana] Length = 119 Score = 61.2 bits (147), Expect = 3e-06 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKKNKY 1628 +ERL+ES+ I+AKYPDR+PVI EKYS++DLP+ME KNKY Sbjct: 15 DERLKESNNIIAKYPDRIPVIIEKYSNADLPDME-KNKY 52 >dbj|BAJ34055.1| unnamed protein product [Thellungiella halophila] Length = 66 Score = 61.2 bits (147), Expect = 3e-06 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKKNKY 1628 +ERL+ES I+AKYPDRVPVI EKYS++DLP+ME KNKY Sbjct: 15 DERLKESKNIIAKYPDRVPVIIEKYSNADLPDME-KNKY 52 >gb|AAF08574.1|AC011623_7 hypothetical protein [Arabidopsis thaliana] Length = 129 Score = 61.2 bits (147), Expect = 3e-06 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -2 Query: 1744 EERLEESSGILAKYPDRVPVIAEKYSSSDLPEMEKKNKY 1628 +ERL+ES+ I+AKYPDR+PVI EKYS++DLP+ME KNKY Sbjct: 25 DERLKESNNIIAKYPDRIPVIIEKYSNADLPDME-KNKY 62