BLASTX nr result
ID: Aconitum23_contig00015249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00015249 (309 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009352094.1| PREDICTED: F-box/kelch-repeat protein At3g23... 57 5e-06 >ref|XP_009352094.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Pyrus x bretschneideri] Length = 424 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = -3 Query: 238 LVFKILIWLPVVCLLRFKLVCKSWCSLIKSSEFIAQH 128 ++ +I+ WLPV+CLLRF+ VCKSW +LI +S+FIA+H Sbjct: 18 IIVEIISWLPVICLLRFRCVCKSWRALISTSDFIAKH 54