BLASTX nr result
ID: Aconitum23_contig00014607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00014607 (452 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA13628.1| hypothetical protein SOVF_114950 [Spinacia oleracea] 83 7e-14 ref|XP_006858916.1| PREDICTED: uncharacterized protein LOC184487... 83 9e-14 ref|XP_010674876.1| PREDICTED: uncharacterized protein LOC104890... 82 1e-13 gb|KDO40444.1| hypothetical protein CISIN_1g041706mg, partial [C... 82 2e-13 ref|XP_006433044.1| hypothetical protein CICLE_v10001390mg [Citr... 82 2e-13 ref|XP_009411266.1| PREDICTED: uncharacterized protein LOC103993... 82 2e-13 ref|XP_002512246.1| conserved hypothetical protein [Ricinus comm... 81 3e-13 ref|XP_012837917.1| PREDICTED: uncharacterized protein LOC105958... 81 3e-13 ref|XP_009763962.1| PREDICTED: uncharacterized protein LOC104215... 81 3e-13 ref|XP_009625183.1| PREDICTED: uncharacterized protein LOC104116... 81 3e-13 ref|XP_008462772.1| PREDICTED: uncharacterized protein LOC103501... 81 3e-13 ref|XP_006347799.1| PREDICTED: uncharacterized protein LOC102599... 81 3e-13 gb|KGN66805.1| hypothetical protein Csa_1G695400 [Cucumis sativus] 81 3e-13 ref|XP_004142521.1| PREDICTED: uncharacterized protein LOC101210... 81 3e-13 ref|XP_003633656.2| PREDICTED: uncharacterized protein LOC100854... 80 5e-13 emb|CBI34209.3| unnamed protein product [Vitis vinifera] 80 5e-13 emb|CAN72331.1| hypothetical protein VITISV_035623 [Vitis vinifera] 80 5e-13 ref|XP_014518711.1| PREDICTED: uncharacterized protein LOC106775... 80 8e-13 gb|KOM52944.1| hypothetical protein LR48_Vigan09g160300 [Vigna a... 80 8e-13 ref|XP_010277329.1| PREDICTED: uncharacterized protein LOC104611... 80 8e-13 >gb|KNA13628.1| hypothetical protein SOVF_114950 [Spinacia oleracea] Length = 399 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E +QKL SIPSSKTMAVEVLWTPQNENDTL+ERE LE+YPLLKPL Sbjct: 355 EAMQKLGSIPSSKTMAVEVLWTPQNENDTLSERELLEDYPLLKPL 399 >ref|XP_006858916.1| PREDICTED: uncharacterized protein LOC18448794 [Amborella trichopoda] gi|548863028|gb|ERN20383.1| hypothetical protein AMTR_s00068p00047550 [Amborella trichopoda] Length = 387 Score = 82.8 bits (203), Expect = 9e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKLASIPSSKT+AVEVLWTPQNE+DTLTERE LE+YPLL+PL Sbjct: 343 EALQKLASIPSSKTLAVEVLWTPQNEDDTLTERELLEDYPLLRPL 387 >ref|XP_010674876.1| PREDICTED: uncharacterized protein LOC104890957 [Beta vulgaris subsp. vulgaris] gi|870862244|gb|KMT13452.1| hypothetical protein BVRB_4g082310 [Beta vulgaris subsp. vulgaris] Length = 398 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKL SIPSSKTMAVEVLWTPQNENDTL+ERE LE+YP LKPL Sbjct: 354 EALQKLGSIPSSKTMAVEVLWTPQNENDTLSERELLEDYPFLKPL 398 >gb|KDO40444.1| hypothetical protein CISIN_1g041706mg, partial [Citrus sinensis] Length = 68 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKLASIPSSK MAVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 24 EALQKLASIPSSKIMAVEVLWTPQNENDTLSERELLEDYPLLRPL 68 >ref|XP_006433044.1| hypothetical protein CICLE_v10001390mg [Citrus clementina] gi|568835341|ref|XP_006471732.1| PREDICTED: uncharacterized protein LOC102608290 [Citrus sinensis] gi|557535166|gb|ESR46284.1| hypothetical protein CICLE_v10001390mg [Citrus clementina] Length = 397 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKLASIPSSK MAVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 353 EALQKLASIPSSKIMAVEVLWTPQNENDTLSERELLEDYPLLRPL 397 >ref|XP_009411266.1| PREDICTED: uncharacterized protein LOC103993062 [Musa acuminata subsp. malaccensis] Length = 389 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKL SIPSSKT+AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 345 EALQKLGSIPSSKTLAVEVLWTPQNENDTLSERELLEDYPLLRPL 389 >ref|XP_002512246.1| conserved hypothetical protein [Ricinus communis] gi|223548207|gb|EEF49698.1| conserved hypothetical protein [Ricinus communis] Length = 360 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKL SIPSSK +AVEVLWTPQNENDTLTERE LE+YPLL+PL Sbjct: 316 EALQKLGSIPSSKVLAVEVLWTPQNENDTLTERELLEDYPLLRPL 360 >ref|XP_012837917.1| PREDICTED: uncharacterized protein LOC105958463 [Erythranthe guttatus] gi|604332343|gb|EYU37047.1| hypothetical protein MIMGU_mgv1a007698mg [Erythranthe guttata] Length = 398 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKLASIPSS+TMAVEVLWTPQNE+DTL+ERE LE+YPLL+PL Sbjct: 354 EALQKLASIPSSRTMAVEVLWTPQNEDDTLSERELLEDYPLLRPL 398 >ref|XP_009763962.1| PREDICTED: uncharacterized protein LOC104215768 [Nicotiana sylvestris] Length = 394 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQK+ASIPSS+T+AVE+LWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 350 EALQKIASIPSSRTLAVEILWTPQNENDTLSERELLEDYPLLRPL 394 >ref|XP_009625183.1| PREDICTED: uncharacterized protein LOC104116092 [Nicotiana tomentosiformis] Length = 394 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQK+ASIPSS+T+AVE+LWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 350 EALQKIASIPSSRTLAVEILWTPQNENDTLSERELLEDYPLLRPL 394 >ref|XP_008462772.1| PREDICTED: uncharacterized protein LOC103501059, partial [Cucumis melo] Length = 178 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKLASIPSSK +AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 134 EALQKLASIPSSKILAVEVLWTPQNENDTLSERELLEDYPLLRPL 178 >ref|XP_006347799.1| PREDICTED: uncharacterized protein LOC102599811 [Solanum tuberosum] Length = 389 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQK+ASIPSS+T+AVE+LWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 345 EALQKIASIPSSRTLAVEILWTPQNENDTLSERELLEDYPLLRPL 389 >gb|KGN66805.1| hypothetical protein Csa_1G695400 [Cucumis sativus] Length = 224 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKLASIPSSK +AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 180 EALQKLASIPSSKILAVEVLWTPQNENDTLSERELLEDYPLLRPL 224 >ref|XP_004142521.1| PREDICTED: uncharacterized protein LOC101210275 [Cucumis sativus] Length = 406 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKLASIPSSK +AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 362 EALQKLASIPSSKILAVEVLWTPQNENDTLSERELLEDYPLLRPL 406 >ref|XP_003633656.2| PREDICTED: uncharacterized protein LOC100854337 [Vitis vinifera] Length = 401 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKL SIPSS+T+AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 357 EALQKLGSIPSSRTLAVEVLWTPQNENDTLSERELLEDYPLLRPL 401 >emb|CBI34209.3| unnamed protein product [Vitis vinifera] Length = 209 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKL SIPSS+T+AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 165 EALQKLGSIPSSRTLAVEVLWTPQNENDTLSERELLEDYPLLRPL 209 >emb|CAN72331.1| hypothetical protein VITISV_035623 [Vitis vinifera] Length = 82 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKL SIPSS+T+AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 38 EALQKLGSIPSSRTLAVEVLWTPQNENDTLSERELLEDYPLLRPL 82 >ref|XP_014518711.1| PREDICTED: uncharacterized protein LOC106775962 [Vigna radiata var. radiata] Length = 379 Score = 79.7 bits (195), Expect = 8e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 + LQKLASIPSSK +AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 335 DALQKLASIPSSKLLAVEVLWTPQNENDTLSERELLEDYPLLRPL 379 >gb|KOM52944.1| hypothetical protein LR48_Vigan09g160300 [Vigna angularis] Length = 379 Score = 79.7 bits (195), Expect = 8e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 + LQKLASIPSSK +AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 335 DALQKLASIPSSKLLAVEVLWTPQNENDTLSERELLEDYPLLRPL 379 >ref|XP_010277329.1| PREDICTED: uncharacterized protein LOC104611801 [Nelumbo nucifera] Length = 402 Score = 79.7 bits (195), Expect = 8e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 451 EGLQKLASIPSSKTMAVEVLWTPQNENDTLTEREFLENYPLLKPL 317 E LQKL SIPS KT+AVEVLWTPQNENDTL+ERE LE+YPLL+PL Sbjct: 358 EALQKLGSIPSRKTLAVEVLWTPQNENDTLSERELLEDYPLLRPL 402