BLASTX nr result
ID: Aconitum23_contig00014343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00014343 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011467427.1| PREDICTED: transcription initiation factor T... 62 2e-07 ref|XP_008228206.1| PREDICTED: transcription initiation factor T... 60 8e-07 ref|XP_007216979.1| hypothetical protein PRUPE_ppa002765mg [Prun... 60 8e-07 ref|XP_009372343.1| PREDICTED: transcription initiation factor T... 59 2e-06 ref|XP_012450306.1| PREDICTED: transcription initiation factor T... 57 7e-06 gb|KJB68265.1| hypothetical protein B456_010G235100 [Gossypium r... 57 7e-06 gb|KJB68264.1| hypothetical protein B456_010G235100 [Gossypium r... 57 7e-06 ref|XP_012450305.1| PREDICTED: transcription initiation factor T... 57 7e-06 ref|XP_012450307.1| PREDICTED: transcription initiation factor T... 57 7e-06 gb|ADL36631.1| C2H2L domain class transcription factor [Malus do... 57 7e-06 ref|XP_009339800.1| PREDICTED: transcription initiation factor T... 56 9e-06 >ref|XP_011467427.1| PREDICTED: transcription initiation factor TFIID subunit 12b [Fragaria vesca subsp. vesca] Length = 624 Score = 62.0 bits (149), Expect = 2e-07 Identities = 33/59 (55%), Positives = 40/59 (67%), Gaps = 3/59 (5%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIRGFGNQISVNHPINP-LSSEHLVSQPTGS--LQQAPRF 213 IR++MESS P+ +NPK+ IRG+GN + NH I P L E LVSQ TGS LQQ RF Sbjct: 566 IRMLMESSQPETNTNNPKEVIRGYGNPVGANHLIRPSLGGEQLVSQATGSQMLQQMTRF 624 >ref|XP_008228206.1| PREDICTED: transcription initiation factor TFIID subunit 12b [Prunus mume] Length = 634 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIRGFGNQISVNHPINPLSSEHLVSQPTGS--LQQAPRF 213 IR +MESSH + +NPK+ +RGFGN + NH L +E LVSQ TGS LQQ RF Sbjct: 577 IRTLMESSHLETNTNNPKEMMRGFGNPVGANHLRPSLGAEQLVSQSTGSQMLQQMTRF 634 >ref|XP_007216979.1| hypothetical protein PRUPE_ppa002765mg [Prunus persica] gi|462413129|gb|EMJ18178.1| hypothetical protein PRUPE_ppa002765mg [Prunus persica] Length = 635 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIRGFGNQISVNHPINPLSSEHLVSQPTGS--LQQAPRF 213 IR +MESSH + +NPK+ +RGFGN + NH L +E LVSQ TGS LQQ RF Sbjct: 578 IRTLMESSHLETNTNNPKEMMRGFGNPVGANHLRPSLGAEQLVSQSTGSQMLQQMTRF 635 >ref|XP_009372343.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like [Pyrus x bretschneideri] gi|694393837|ref|XP_009372344.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like [Pyrus x bretschneideri] Length = 634 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/59 (55%), Positives = 40/59 (67%), Gaps = 3/59 (5%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIRGFGNQISVNHPINP-LSSEHLVSQPTGS--LQQAPRF 213 IR +MESS+ D + PK+ IRGFGN +S NH I P L +E LVSQ TGS +QQ RF Sbjct: 576 IRALMESSNLDTNPNTPKEMIRGFGNPVSGNHLIKPSLGAEQLVSQSTGSQMMQQMTRF 634 >ref|XP_012450306.1| PREDICTED: transcription initiation factor TFIID subunit 12b isoform X2 [Gossypium raimondii] Length = 628 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIR-GFGNQISVNHPINPL-SSEHLVSQPTGS--LQQAPRF 213 IR +MESSHP+I A+NPK+ IR G GN + N+ + P SSE LVSQ GS LQQ R+ Sbjct: 569 IRALMESSHPEINANNPKEMIRQGLGNPVGANNLMRPSPSSEQLVSQAAGSQMLQQITRY 628 >gb|KJB68265.1| hypothetical protein B456_010G235100 [Gossypium raimondii] Length = 620 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIR-GFGNQISVNHPINPL-SSEHLVSQPTGS--LQQAPRF 213 IR +MESSHP+I A+NPK+ IR G GN + N+ + P SSE LVSQ GS LQQ R+ Sbjct: 561 IRALMESSHPEINANNPKEMIRQGLGNPVGANNLMRPSPSSEQLVSQAAGSQMLQQITRY 620 >gb|KJB68264.1| hypothetical protein B456_010G235100 [Gossypium raimondii] Length = 613 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIR-GFGNQISVNHPINPL-SSEHLVSQPTGS--LQQAPRF 213 IR +MESSHP+I A+NPK+ IR G GN + N+ + P SSE LVSQ GS LQQ R+ Sbjct: 554 IRALMESSHPEINANNPKEMIRQGLGNPVGANNLMRPSPSSEQLVSQAAGSQMLQQITRY 613 >ref|XP_012450305.1| PREDICTED: transcription initiation factor TFIID subunit 12b isoform X1 [Gossypium raimondii] gi|763801308|gb|KJB68263.1| hypothetical protein B456_010G235100 [Gossypium raimondii] Length = 631 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIR-GFGNQISVNHPINPL-SSEHLVSQPTGS--LQQAPRF 213 IR +MESSHP+I A+NPK+ IR G GN + N+ + P SSE LVSQ GS LQQ R+ Sbjct: 572 IRALMESSHPEINANNPKEMIRQGLGNPVGANNLMRPSPSSEQLVSQAAGSQMLQQITRY 631 >ref|XP_012450307.1| PREDICTED: transcription initiation factor TFIID subunit 12b isoform X3 [Gossypium raimondii] gi|763801305|gb|KJB68260.1| hypothetical protein B456_010G235100 [Gossypium raimondii] gi|763801307|gb|KJB68262.1| hypothetical protein B456_010G235100 [Gossypium raimondii] Length = 623 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIR-GFGNQISVNHPINPL-SSEHLVSQPTGS--LQQAPRF 213 IR +MESSHP+I A+NPK+ IR G GN + N+ + P SSE LVSQ GS LQQ R+ Sbjct: 564 IRALMESSHPEINANNPKEMIRQGLGNPVGANNLMRPSPSSEQLVSQAAGSQMLQQITRY 623 >gb|ADL36631.1| C2H2L domain class transcription factor [Malus domestica] Length = 630 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 3/59 (5%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIRGFGNQISVNHPINP-LSSEHLVSQPTGS--LQQAPRF 213 IR +MESS+ + + PK+ IRGFGN + NH I P L +E LVSQ TGS LQQ RF Sbjct: 572 IRTLMESSNLEKNPNTPKEMIRGFGNAVGTNHLIRPSLGAEQLVSQSTGSQMLQQMTRF 630 >ref|XP_009339800.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like [Pyrus x bretschneideri] Length = 635 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/59 (52%), Positives = 39/59 (66%), Gaps = 3/59 (5%) Frame = -2 Query: 380 IRVMMESSHPDIKADNPKDSIRGFGNQISVNHPINP-LSSEHLVSQPTGS--LQQAPRF 213 IR +MESS+ + + PK+ IRGFGN + NH I P + +E LVSQ TGS LQQ RF Sbjct: 577 IRTLMESSNLETNPNTPKEMIRGFGNPVGTNHLIRPSVGAEQLVSQSTGSQMLQQMTRF 635